DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and pin-2

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001255672.1 Gene:pin-2 / 178234 WormBaseID:WBGene00004030 Length:330 Species:Caenorhabditis elegans


Alignment Length:52 Identity:11/52 - (21%)
Similarity:20/52 - (38%) Gaps:6/52 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   647 YRPKDAYNDEFIAETLSAQAELITGSTLGVNFMKYQKPERKIDLNRSEVYKY 698
            |.|..|..:||:.      .:::..|....:...:...|..:.||....|:|
 Worm    78 YAPVCAKCNEFVI------GQVVHSSNNSYHLACFTCDECNVHLNSQIAYRY 123

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492
DUF4749 653..>699 CDD:292558 8/46 (17%)