DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and ZK1321.4

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001254228.1 Gene:ZK1321.4 / 174538 WormBaseID:WBGene00014262 Length:429 Species:Caenorhabditis elegans


Alignment Length:107 Identity:29/107 - (27%)
Similarity:51/107 - (47%) Gaps:24/107 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LDIKMCRFD-NVPWGFRLVGGADYDYPLTVVKVTEGSIADEAGLRVEDIIVRINDTAATPLTHDE 66
            :.::|.|.| |:.|||.:...||   .|.:.:|...|::|:||::..|.:.:||..:...|....
 Worm    12 ISVRMNRSDRNIRWGFSVRQQAD---GLIIDRVEAESLSDKAGVKHNDKVDQINGRSTRGLDAAS 73

  Fly    67 AHRLIMGSGSVFYFGVYRENEEDAYE----CLKKFPTSEGSL 104
            |:|||                :|::.    .|::|.||..:|
 Worm    74 ANRLI----------------DDSFNEVRLSLQRFVTSHTTL 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 23/72 (32%)
DUF4749 653..>699 CDD:292558
ZK1321.4NP_001254228.1 PDZ_signaling 11..90 CDD:238492 24/96 (25%)
ZM 346..371 CDD:128974
DUF4749 349..429 CDD:374237
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.