DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and Pdlim3

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_446102.2 Gene:Pdlim3 / 114108 RGDID:620427 Length:364 Species:Rattus norvegicus


Alignment Length:285 Identity:65/285 - (22%)
Similarity:108/285 - (37%) Gaps:65/285 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PWGFRLVGGADYDYPLTVVKVTEGSIADEAGLRVEDIIVRINDTAATPLTHDEAHRLIM------ 72
            ||||||.||.|::.||.:.::|.||.|:.|.|...|:|:.|:......:||.:|...|.      
  Rat    12 PWGFRLSGGIDFNQPLVITRITPGSKAEAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQL 76

  Fly    73 -------------------GSGSVFYFGVYRENEEDAYECLKKFPTSEGSLTKSPMPTISPSPTP 118
                               |....|...:..|.::..|        .|......|.|.|.|..|.
  Rat    77 CLKIDRAETRLWSPQVSEDGKAHPFKINLEAEPQDVNY--------FEHKHNIRPKPFIIPGRTS 133

  Fly   119 SLSQ---LTETTNARTPEPEPFVP--LPRELAAATMAAPAVEVDVD------VLAECRQPMSEVH 172
            ..|.   :...:...||.....|.  .|.:|..|...||.:.::::      |.|:...|| :::
  Rat   134 GCSTPSGIDCGSGRSTPSSVSTVSTICPGDLKVAAKMAPNIPLEMELPGVKIVHAQFNTPM-QLY 197

  Fly   173 SEEK-----RGDVNG--HDAPGQADEGGL--PVENLY--LPDLPDRPCSALSERQEIKLVEEEI- 225
            |::.     :|.|:.  .:.|..::....  |..::|  |.|..|.| :|..:....::::|.: 
  Rat   198 SDDNIMETLQGQVSTALGETPSMSEPTASVPPQSDVYRMLHDNRDEP-AAPRQSGSFRVLQELVN 261

  Fly   226 -------AAVLSGESEVLKEHNVLG 243
                   |...|..:.|.|.|...|
  Rat   262 DGSDDRPAGTRSVRAPVTKVHGGAG 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 25/85 (29%)
DUF4749 653..>699 CDD:292558
Pdlim3NP_446102.2 PDZ_signaling 2..80 CDD:238492 24/67 (36%)
DUF4749 184..263 CDD:406377 16/80 (20%)
LIM_ALP 294..346 CDD:188834
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.