DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and Gm20498

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001296776.1 Gene:Gm20498 / 105940408 MGIID:5141963 Length:182 Species:Mus musculus


Alignment Length:143 Identity:38/143 - (26%)
Similarity:56/143 - (39%) Gaps:28/143 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GFRLVGGADYDY-----PLTVVKVTE-GSIADEAGLRVEDIIVRINDTAATPLTHDEA------- 67
            ||.:|||.|..|     .:.|.::.| |:.|.:..|:..|.|:.:|......|.|.:|       
Mouse    24 GFNIVGGTDQQYVSNDSGIYVSRIKEDGAAAQDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNA 88

  Fly    68 ---------HRLIMGSGSVFYFGVYRENEEDAYEC--LKKFPTSEGSLTKSPMPTISPSPTPSLS 121
                     |||::..||   ||: ||..:..|:.  :|..|..|..|..:.:...|.......|
Mouse    89 GCAVSLRVQHRLLVVGGS---FGL-REFSQIRYDAVTIKIDPELEKKLKVNKITLESEYEKIKDS 149

  Fly   122 QLTETTNARTPEP 134
            ......|.|.|.|
Mouse   150 TFENWKNIRGPRP 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 21/80 (26%)
DUF4749 653..>699 CDD:292558
Gm20498NP_001296776.1 PDZ_signaling 13..97 CDD:238492 18/72 (25%)
COX16 100..164 CDD:372923 18/67 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.