DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and LIMS4

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001358269.1 Gene:LIMS4 / 100288695 HGNCID:39941 Length:398 Species:Homo sapiens


Alignment Length:266 Identity:48/266 - (18%)
Similarity:70/266 - (26%) Gaps:128/266 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   496 IDENSGNEEQVEEGVTTATNTINTAGETEDAGKDISISGSDNPPVGPCESNEDRCDANDREVAEI 560
            |.||       ||....|.||::.|..|||                            :|.|:::
Human    12 IPEN-------EEIPRAALNTVHEANGTED----------------------------ERAVSKL 41

  Fly   561 SRSTDDNRLAKD----------------------------------KKKDLDQEQ----KQQQQQ 587
            .|...|.::.|:                                  ...:|..||    .|..||
Human    42 QRRHSDVKVYKEFCDFYAKFNMANALASATCERCKGGFAPAETIVNSNGELYHEQCFVCAQCFQQ 106

  Fly   588 QQEPLSEEQNFKKQKRHD-------------------VIEELE---------------------- 611
            ..|.|..|...:|...||                   ||:.:.                      
Human   107 FPEGLFYEFEGRKYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGF 171

  Fly   612 -----EHLVRKNNPRRSKRAFGPLVPS------SERPLVLPGGRRWYRPKDAYNDEFIAETLSAQ 665
                 .||.|..:.|...|..|..:..      .|:||:.....  |.| |.:|.....:.|:|.
Human   172 VKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDP--YHP-DHFNCANCGKDLTAD 233

  Fly   666 AELITG 671
            |:.:.|
Human   234 AQELKG 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492
DUF4749 653..>699 CDD:292558 5/19 (26%)
LIMS4NP_001358269.1 LIM1_PINCH 72..130 CDD:188717 12/57 (21%)
LIM2_PINCH 133..184 CDD:188718 5/50 (10%)
LIM3_PINCH 197..247 CDD:188719 11/46 (24%)
LIM4_PINCH 253..306 CDD:188720
LIM5_PINCH 314..367 CDD:188721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154976
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.