Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055632.2 | Gene: | TRIL / 9865 | HGNCID: | 22200 | Length: | 811 | Species: | Homo sapiens |
Alignment Length: | 336 | Identity: | 114/336 - (33%) |
---|---|---|---|
Similarity: | 165/336 - (49%) | Gaps: | 36/336 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 158 NFSHNALKQCDLPHMPLLNRLELGHNRLVN---ATFGVCPQLQELILNDNQLIQLDVNAFRGLHG 219
Fly 220 LLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFV-LHLQQLDLSGNRIR 283
Fly 284 LLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLD 348
Fly 349 LSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFA 413
Fly 414 PMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLA-KVNVSFPNLKRVAIEGNPWQC 477
Fly 478 PCFVK-LQHWL 487 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 33/100 (33%) |
LRR_8 | 104..164 | CDD:290566 | 3/5 (60%) | ||
leucine-rich repeat | 106..129 | CDD:275380 | |||
leucine-rich repeat | 130..153 | CDD:275380 | |||
leucine-rich repeat | 154..195 | CDD:275380 | 11/39 (28%) | ||
LRR_RI | 194..455 | CDD:238064 | 92/261 (35%) | ||
LRR_8 | 194..254 | CDD:290566 | 20/59 (34%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 220..243 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 244..267 | CDD:275380 | 11/22 (50%) | ||
LRR_8 | 271..330 | CDD:290566 | 19/58 (33%) | ||
leucine-rich repeat | 272..295 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 296..319 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 319..380 | CDD:290566 | 25/60 (42%) | ||
leucine-rich repeat | 320..343 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 344..369 | CDD:275380 | 11/24 (46%) | ||
LRR_8 | 368..428 | CDD:290566 | 23/59 (39%) | ||
leucine-rich repeat | 370..393 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 394..417 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 418..441 | CDD:275380 | 6/22 (27%) | ||
TRIL | NP_055632.2 | LRR_RI | <2..194 | CDD:238064 | 45/130 (35%) |
leucine-rich repeat | 37..61 | CDD:275380 | |||
LRR 1 | 61..81 | 4/12 (33%) | |||
leucine-rich repeat | 62..84 | CDD:275380 | 4/15 (27%) | ||
LRR_8 | 84..143 | CDD:290566 | 19/58 (33%) | ||
LRR 2 | 84..105 | 7/20 (35%) | |||
leucine-rich repeat | 85..108 | CDD:275380 | 7/22 (32%) | ||
LRR 3 | 108..129 | 7/20 (35%) | |||
leucine-rich repeat | 109..132 | CDD:275380 | 8/22 (36%) | ||
LRR 4 | 132..153 | 6/20 (30%) | |||
leucine-rich repeat | 133..156 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 156..215 | CDD:290566 | 27/66 (41%) | ||
LRR 5 | 156..177 | 11/20 (55%) | |||
leucine-rich repeat | 157..180 | CDD:275380 | 11/22 (50%) | ||
LRR 6 | 180..201 | 11/25 (44%) | |||
leucine-rich repeat | 181..204 | CDD:275380 | 11/27 (41%) | ||
LRR 7 | 204..223 | 9/40 (23%) | |||
leucine-rich repeat | 205..254 | CDD:275380 | 25/72 (35%) | ||
LRR 8 | 230..251 | 10/22 (45%) | |||
LRR_8 | 239..289 | CDD:290566 | 23/51 (45%) | ||
LRR_RI | <249..>364 | CDD:238064 | 38/116 (33%) | ||
LRR 9 | 254..275 | 10/20 (50%) | |||
leucine-rich repeat | 255..278 | CDD:275380 | 10/22 (45%) | ||
LRR 10 | 278..299 | 6/20 (30%) | |||
LRR_8 | 279..337 | CDD:290566 | 16/57 (28%) | ||
leucine-rich repeat | 279..302 | CDD:275380 | 7/22 (32%) | ||
LRR 11 | 302..323 | 5/20 (25%) | |||
leucine-rich repeat | 303..326 | CDD:275380 | 6/22 (27%) | ||
LRR 12 | 326..347 | 5/20 (25%) | |||
leucine-rich repeat | 327..346 | CDD:275380 | 5/18 (28%) | ||
leucine-rich repeat | 351..363 | CDD:275378 | 5/11 (45%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 484..549 | ||||
fn3 | 589..667 | CDD:278470 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R11342 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.940 |