DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and AT5G19680

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_197469.1 Gene:AT5G19680 / 832088 AraportID:AT5G19680 Length:328 Species:Arabidopsis thaliana


Alignment Length:324 Identity:82/324 - (25%)
Similarity:153/324 - (47%) Gaps:68/324 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 LDVNAFRGLH---------GLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALD--ALRP-NV 261
            ||:.::: ||         .|:||.|:.||||.:.....| |:.|:||:|.||.:|  |:.| :.
plant    20 LDLTSYQ-LHSLDTVELPPNLIELDLTANRLSGLDSRIAQ-LSTLKKLSLRQNLIDDSAVEPLSH 82

  Fly   262 FGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGL----GSLRK 322
            :.|:.:    |::|.|..|::..:.|  ..:..:|.:.|:|.|.|.||.     |:    .:|::
plant    83 WDALSD----LEELVLRDNKLAKVPD--VSIFTKLLVYDISFNEITSLE-----GISKASSTLKE 136

  Fly   323 LYL---QYNAILEIKPATFAALLNLDTLDLSYNNLEFLE--------EQIFGGNT---------L 367
            ||:   :.|.|:||:     .|.||..|:|..|.|..:|        |:::.|..         |
plant   137 LYVSKNEVNKIMEIE-----HLHNLQILELGSNRLRVMENLENFTKLEELWLGRNRIKVVNLCGL 196

  Fly   368 PRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEIN 432
            ..:::::|..||:..:.  .|.....||.|.|.||.:..::  ..:.:..|:.|.:.:|.|..: 
plant   197 KCIKKISLQSNRLTSMK--GFEECVALEELYLSHNGISKME--GLSALVNLRVLDVSNNKLTSV- 256

  Fly   433 LDVLESLSSVQEILVDNNRLTFL----AKVNVSFPNLKRVAIEGNPWQCPCFVKLQHWLATRDV 492
             |.:::|:.::::.:::|::..|    ..|..|...|..:.:|.|    ||.....:..|.|.:
plant   257 -DDIQNLTKLEDLWLNDNQIESLEAITEAVTGSKEKLTTIYLENN----PCAKSSDYVAAVRQI 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 21/57 (37%)
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380
LRR_RI 194..455 CDD:238064 72/281 (26%)
LRR_8 194..254 CDD:290566 20/53 (38%)
leucine-rich repeat 196..219 CDD:275380 4/18 (22%)
leucine-rich repeat 220..243 CDD:275380 10/22 (45%)
leucine-rich repeat 244..267 CDD:275380 10/25 (40%)
LRR_8 271..330 CDD:290566 17/65 (26%)
leucine-rich repeat 272..295 CDD:275380 5/22 (23%)
leucine-rich repeat 296..319 CDD:275380 8/26 (31%)
LRR_8 319..380 CDD:290566 20/80 (25%)
leucine-rich repeat 320..343 CDD:275380 8/25 (32%)
leucine-rich repeat 344..369 CDD:275380 9/41 (22%)
LRR_8 368..428 CDD:290566 13/59 (22%)
leucine-rich repeat 370..393 CDD:275380 4/22 (18%)
leucine-rich repeat 394..417 CDD:275380 6/22 (27%)
leucine-rich repeat 418..441 CDD:275380 6/22 (27%)
AT5G19680NP_197469.1 leucine-rich repeat 19..38 CDD:275380 4/18 (22%)
internalin_A <20..>183 CDD:380193 53/180 (29%)
leucine-rich repeat 39..61 CDD:275380 10/22 (45%)
leucine-rich repeat 62..88 CDD:275380 10/25 (40%)
leucine-rich repeat 89..110 CDD:275380 5/22 (23%)
leucine-rich repeat 111..133 CDD:275380 8/26 (31%)
PPP1R42 121..308 CDD:411060 47/206 (23%)
leucine-rich repeat 134..155 CDD:275380 8/25 (32%)
leucine-rich repeat 156..177 CDD:275380 6/20 (30%)
leucine-rich repeat 178..198 CDD:275380 3/19 (16%)
leucine-rich repeat 199..220 CDD:275380 4/22 (18%)
leucine-rich repeat 221..242 CDD:275380 6/22 (27%)
leucine-rich repeat 243..264 CDD:275380 6/22 (27%)
leucine-rich repeat 265..291 CDD:275380 4/25 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.