DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and AT5G12940

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_196798.1 Gene:AT5G12940 / 831134 AraportID:AT5G12940 Length:371 Species:Arabidopsis thaliana


Alignment Length:408 Identity:90/408 - (22%)
Similarity:146/408 - (35%) Gaps:110/408 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GADLCQPIGWRNFQCSEVASLQDLVDLGAENWHTLAIRNVQTELEVGSGENADHL---ANLLDLD 86
            |.|.|:  ||....|..               :|..:..:...     ||:.|.|   |....| 
plant    55 GLDCCK--GWYGVSCDP---------------NTRRVAGITLR-----GESEDPLFQKAKRSGL- 96

  Fly    87 LTGAAPINVHTNGFSILPNLRQL-NLSGCGLVDIRGNHFAPESALQRIDFSHNQMELLDRDFFGN 150
            :||           ||.|::.:| .|||..:.|.:|                             
plant    97 MTG-----------SISPSICKLTRLSGIIIADWKG----------------------------- 121

  Fly   151 LRKLIYANFSHNALKQCDLPHMPLLNRLELGHNRLVNATFGVCPQLQELILNDNQLIQLDVNAFR 215
                     ....:..| :.::|.|..|:|..|:.    .||.|      .|..:|::|.|    
plant   122 ---------ISGVIPSC-IENLPFLRHLDLVGNKF----SGVIP------ANIGKLLRLKV---- 162

  Fly   216 GLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGN 280
                   |.|:.|.|..:...:...|..|..|:|..|.:..:.|...|.::    .:.::.||||
plant   163 -------LNLADNHLYGVIPPSITRLVSLSHLDLRNNNISGVIPRDIGRLK----MVSRVLLSGN 216

  Fly   281 RIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLD 345
            :|.....:....:.||..|::|.|.:....||.|..:..|..|.|..|.|..:.|.:..| .::.
plant   217 KISGQIPDSLTRIYRLADLELSMNRLTGPIPASFGKMSVLATLNLDGNLISGMIPGSLLA-SSIS 280

  Fly   346 TLDLSYNNLEFLEEQIFGGNTLPR--MRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLD 408
            .|:||.|.:.......||    ||  ...|:|..||::...|.:.::..|:.:|.:.||.|.. .
plant   281 NLNLSGNLITGSIPNTFG----PRSYFTVLDLANNRLQGPIPASITAASFIGHLDVSHNHLCG-K 340

  Fly   409 VRMFAPMRRLQKLHLGHN 426
            :.|.:|...|......:|
plant   341 IPMGSPFDHLDATSFAYN 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 29/153 (19%)
LRR_8 104..164 CDD:290566 7/60 (12%)
leucine-rich repeat 106..129 CDD:275380 6/23 (26%)
leucine-rich repeat 130..153 CDD:275380 0/22 (0%)
leucine-rich repeat 154..195 CDD:275380 8/40 (20%)
LRR_RI 194..455 CDD:238064 58/235 (25%)
LRR_8 194..254 CDD:290566 14/59 (24%)
leucine-rich repeat 196..219 CDD:275380 4/22 (18%)
leucine-rich repeat 220..243 CDD:275380 5/22 (23%)
leucine-rich repeat 244..267 CDD:275380 6/22 (27%)
LRR_8 271..330 CDD:290566 17/58 (29%)
leucine-rich repeat 272..295 CDD:275380 5/22 (23%)
leucine-rich repeat 296..319 CDD:275380 7/22 (32%)
LRR_8 319..380 CDD:290566 18/62 (29%)
leucine-rich repeat 320..343 CDD:275380 7/22 (32%)
leucine-rich repeat 344..369 CDD:275380 6/24 (25%)
LRR_8 368..428 CDD:290566 16/61 (26%)
leucine-rich repeat 370..393 CDD:275380 5/22 (23%)
leucine-rich repeat 394..417 CDD:275380 6/22 (27%)
leucine-rich repeat 418..441 CDD:275380 2/9 (22%)
AT5G12940NP_196798.1 PLN00113 35..>344 CDD:215061 86/392 (22%)
leucine-rich repeat 136..159 CDD:275380 9/32 (28%)
leucine-rich repeat 160..183 CDD:275380 7/33 (21%)
leucine-rich repeat 184..207 CDD:275380 6/26 (23%)
leucine-rich repeat 208..231 CDD:275380 5/22 (23%)
leucine-rich repeat 232..255 CDD:275380 7/22 (32%)
leucine-rich repeat 256..278 CDD:275380 7/22 (32%)
leucine-rich repeat 279..302 CDD:275380 8/26 (31%)
leucine-rich repeat 303..322 CDD:275380 5/18 (28%)
leucine-rich repeat 329..350 CDD:275380 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.