DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and PIRL2

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_189281.2 Gene:PIRL2 / 822257 AraportID:AT3G26500 Length:471 Species:Arabidopsis thaliana


Alignment Length:319 Identity:83/319 - (26%)
Similarity:152/319 - (47%) Gaps:41/319 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 APESALQ---------RIDFSHNQMELLDRDFFGNLRKLIYANFSHNALK---QCDLPHMPLLNR 177
            :||.|.:         |:|..|:..|...:|....|.: :|:....:.|:   :.:...:.:|..
plant    92 SPEEAAKESEIYAGVVRLDEVHDSYEKKLKDTEEELSR-VYSTEVESMLRSGEEVNEKVLAVLKE 155

  Fly   178 LELGHNRLVNATFGVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLA 242
            .|.|..            ::.:.|:..:| :|...||..:.||:.|.||||.|:.|. :....|.
plant   156 AESGGT------------VERIDLSSQEL-KLIPEAFWKVVGLVYLNLSGNDLTFIP-DAISKLK 206

  Fly   243 QLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIA 307
            :|.:|::|.|:|::| |:..|    .:|:|:.|:::.|.:..|.::.....:.:: ||.|.|::.
plant   207 KLEELDVSSNSLESL-PDSIG----MLLNLRILNVNANNLTALPESIAHCRSLVE-LDASYNNLT 265

  Fly   308 SLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRR 372
            ||......||.:|.:|.:|.|. |...|.:.:.:.||..||...|.:..:...|   ..|.::..
plant   266 SLPTNIGYGLQNLERLSIQLNK-LRYFPGSISEMYNLKYLDAHMNEIHGIPNSI---GRLTKLEV 326

  Fly   373 LNLNGNRMKHLH--PLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLE 429
            |||:.| ..:|.  |...:.|..|..|.|.:|:::::. ..|..:|:|:||:|..|.||
plant   327 LNLSSN-FNNLMGVPDTITDLTNLRELDLSNNQIQAIP-DSFYRLRKLEKLNLDQNPLE 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 34/142 (24%)
LRR_8 104..164 CDD:290566 10/47 (21%)
leucine-rich repeat 106..129 CDD:275380 2/3 (67%)
leucine-rich repeat 130..153 CDD:275380 6/31 (19%)
leucine-rich repeat 154..195 CDD:275380 5/43 (12%)
LRR_RI 194..455 CDD:238064 69/238 (29%)
LRR_8 194..254 CDD:290566 19/59 (32%)
leucine-rich repeat 196..219 CDD:275380 5/22 (23%)
leucine-rich repeat 220..243 CDD:275380 9/22 (41%)
leucine-rich repeat 244..267 CDD:275380 8/22 (36%)
LRR_8 271..330 CDD:290566 16/58 (28%)
leucine-rich repeat 272..295 CDD:275380 4/22 (18%)
leucine-rich repeat 296..319 CDD:275380 8/22 (36%)
LRR_8 319..380 CDD:290566 17/60 (28%)
leucine-rich repeat 320..343 CDD:275380 6/22 (27%)
leucine-rich repeat 344..369 CDD:275380 6/24 (25%)
LRR_8 368..428 CDD:290566 18/61 (30%)
leucine-rich repeat 370..393 CDD:275380 7/24 (29%)
leucine-rich repeat 394..417 CDD:275380 5/22 (23%)
leucine-rich repeat 418..441 CDD:275380 7/12 (58%)
PIRL2NP_189281.2 leucine-rich repeat 162..184 CDD:275380 5/22 (23%)
LRR_RI 169..408 CDD:238064 68/229 (30%)
LRR_8 184..241 CDD:290566 22/62 (35%)
leucine-rich repeat 185..207 CDD:275380 9/22 (41%)
leucine-rich repeat 208..230 CDD:275380 8/26 (31%)
LRR_8 230..288 CDD:290566 16/59 (27%)
leucine-rich repeat 231..253 CDD:275380 4/21 (19%)
leucine-rich repeat 254..277 CDD:275380 8/23 (35%)
leucine-rich repeat 278..300 CDD:275380 6/22 (27%)
leucine-rich repeat 301..323 CDD:275380 6/24 (25%)
LRR_8 322..382 CDD:290566 18/61 (30%)
leucine-rich repeat 324..348 CDD:275380 7/24 (29%)
leucine-rich repeat 349..371 CDD:275380 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.