DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and PIRL5

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_179336.1 Gene:PIRL5 / 816250 AraportID:AT2G17440 Length:526 Species:Arabidopsis thaliana


Alignment Length:316 Identity:92/316 - (29%)
Similarity:151/316 - (47%) Gaps:40/316 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 ESALQRIDFSHNQMELLD--RDFFGNLRKLIYANFSHNALKQCDLPHMPLLNRLELGHNRLVNAT 189
            :.|.|.::..|..|:.|:  .|..|.|..|:..:.|.|.:                   .::.||
plant   203 KKATQELNLQHRLMDQLEWLPDSLGKLSSLVRLDLSENCI-------------------MVLPAT 248

  Fly   190 FGVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNAL 254
            .|....|..|.|:.|::.||. .:...|..|:.|.||||:|||:. .:|..|..|.:|:||.|:|
plant   249 IGGLISLTRLDLHSNRIGQLP-ESIGDLLNLVNLNLSGNQLSSLP-SSFNRLIHLEELDLSSNSL 311

  Fly   255 DALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVG-LG 318
            ..| |...|:    ::.|::||:..|.|..: .:.....:.::.|....|.:.:|..|  || |.
plant   312 SIL-PESIGS----LVSLKKLDVETNNIEEI-PHSISGCSSMEELRADYNRLKALPEA--VGKLS 368

  Fly   319 SLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHL 383
            :|..|.::||.|.:: |.|.:::.||..||:|:|.||.:.|.:....||.   :||: ||...:|
plant   369 TLEILTVRYNNIRQL-PTTMSSMANLKELDVSFNELESVPESLCYAKTLV---KLNI-GNNFANL 428

  Fly   384 H--PLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLE 437
            .  |....:|..||.|.:.:|:::.|.. .|..:..|:.|....|.|||:..|:.|
plant   429 RSLPGLIGNLEKLEELDMSNNQIRFLPY-SFKTLSNLRVLQTEQNPLEELPRDITE 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 38/130 (29%)
LRR_8 104..164 CDD:290566 11/38 (29%)
leucine-rich repeat 106..129 CDD:275380 0/1 (0%)
leucine-rich repeat 130..153 CDD:275380 7/24 (29%)
leucine-rich repeat 154..195 CDD:275380 6/40 (15%)
LRR_RI 194..455 CDD:238064 78/247 (32%)
LRR_8 194..254 CDD:290566 23/59 (39%)
leucine-rich repeat 196..219 CDD:275380 7/22 (32%)
leucine-rich repeat 220..243 CDD:275380 11/22 (50%)
leucine-rich repeat 244..267 CDD:275380 9/22 (41%)
LRR_8 271..330 CDD:290566 16/59 (27%)
leucine-rich repeat 272..295 CDD:275380 5/22 (23%)
leucine-rich repeat 296..319 CDD:275380 7/23 (30%)
LRR_8 319..380 CDD:290566 22/60 (37%)
leucine-rich repeat 320..343 CDD:275380 7/22 (32%)
leucine-rich repeat 344..369 CDD:275380 10/24 (42%)
LRR_8 368..428 CDD:290566 16/61 (26%)
leucine-rich repeat 370..393 CDD:275380 7/24 (29%)
leucine-rich repeat 394..417 CDD:275380 6/22 (27%)
leucine-rich repeat 418..441 CDD:275380 8/20 (40%)
PIRL5NP_179336.1 LRR_RI 202..451 CDD:238064 82/281 (29%)
leucine-rich repeat 206..231 CDD:275380 7/24 (29%)
LRR_8 207..265 CDD:290566 17/76 (22%)
leucine-rich repeat 232..254 CDD:275380 6/40 (15%)
LRR_8 254..334 CDD:290566 31/86 (36%)
leucine-rich repeat 255..300 CDD:275380 18/46 (39%)
leucine-rich repeat 301..323 CDD:275380 9/26 (35%)
leucine-rich repeat 324..346 CDD:275380 5/22 (23%)
LRR_8 345..403 CDD:290566 20/60 (33%)
leucine-rich repeat 347..369 CDD:275380 7/23 (30%)
leucine-rich repeat 370..392 CDD:275380 7/22 (32%)
leucine-rich repeat 393..440 CDD:275380 17/50 (34%)
LRR_8 414..474 CDD:290566 18/64 (28%)
leucine-rich repeat 441..463 CDD:275380 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2317
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.