DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and lrrn3

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001072526.1 Gene:lrrn3 / 779981 XenbaseID:XB-GENE-490955 Length:706 Species:Xenopus tropicalis


Alignment Length:415 Identity:98/415 - (23%)
Similarity:163/415 - (39%) Gaps:99/415 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 NLLDLDLTGAAPINVHTNGFSI---LPNLRQ-LNLSGCGLVDIRGNHFAPESALQRIDFSHNQME 141
            |.|||              :|:   ||...| |.|....:.:|:.....|.: |..:|.|.|.:.
 Frog    56 NALDL--------------YSVPDKLPAKTQILLLQANNIEEIKNTDHFPVN-LTGLDLSQNNLS 105

  Fly   142 LLDRDFFGNLRKLIYANFSHNALKQCDLPHMPLLNRLELGHNRLVNATFGVCPQLQELILNDNQL 206
            |:....|.|:.:::......|.|.:                  |:..:|.....||||.:|.|.:
 Frog   106 LIANINFTNMHQILSVYLEENKLTE------------------LMEGSFSGLENLQELYINHNLI 152

  Fly   207 IQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNF--V 269
            ..:...||.|:..||.|.|:.|||..|....|:.:..|..|.:.:|      |.|.....||  :
 Frog   153 SVISPKAFAGVSNLLRLHLNSNRLQMINSMWFEAIPNLEILMIGEN------PIVNIEDMNFKPL 211

  Fly   270 LHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIK 334
            ::|:.|.|:|..:..:.||.|..|.:|:.:....|....:.......:.:|:.|.|..|.:..|:
 Frog   212 INLRSLVLAGVNLTEIPDNAFLGLDKLESISFYDNKFIHVPSVALQKVVNLKFLDLNKNPVRRIQ 276

  Fly   335 PATFAALLNLDTLDLSYNNL-EFLEEQIFGGNTLPRMRRLNLNGN-RMKHLHPLAFSSLPFLEYL 397
            ...|:.:|:|.  :|..||: |.:.........||.:|::....| ::.::||.||..||.||.|
 Frog   277 RGDFSNMLHLK--ELGINNMPELVSIDSLAIENLPELRKIEATNNPKLAYIHPNAFYRLPKLETL 339

  Fly   398 KLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKVNVSF 462
            .|..|                                   |||::....::            :.
 Frog   340 MLNSN-----------------------------------SLSAIYRSTIE------------AL 357

  Fly   463 PNLKRVAIEGNPWQCPCFVKLQHWL 487
            ||||.::|..||.:|.|.::   |:
 Frog   358 PNLKEISIHSNPMRCDCVIR---WI 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 39/153 (25%)
LRR_8 104..164 CDD:290566 14/60 (23%)
leucine-rich repeat 106..129 CDD:275380 5/23 (22%)
leucine-rich repeat 130..153 CDD:275380 7/22 (32%)
leucine-rich repeat 154..195 CDD:275380 4/40 (10%)
LRR_RI 194..455 CDD:238064 65/264 (25%)
LRR_8 194..254 CDD:290566 21/59 (36%)
leucine-rich repeat 196..219 CDD:275380 9/22 (41%)
leucine-rich repeat 220..243 CDD:275380 9/22 (41%)
leucine-rich repeat 244..267 CDD:275380 5/22 (23%)
LRR_8 271..330 CDD:290566 14/58 (24%)
leucine-rich repeat 272..295 CDD:275380 8/22 (36%)
leucine-rich repeat 296..319 CDD:275380 2/22 (9%)
LRR_8 319..380 CDD:290566 16/62 (26%)
leucine-rich repeat 320..343 CDD:275380 6/22 (27%)
leucine-rich repeat 344..369 CDD:275380 6/25 (24%)
LRR_8 368..428 CDD:290566 14/60 (23%)
leucine-rich repeat 370..393 CDD:275380 7/23 (30%)
leucine-rich repeat 394..417 CDD:275380 5/22 (23%)
leucine-rich repeat 418..441 CDD:275380 2/22 (9%)
lrrn3NP_001072526.1 leucine-rich repeat 52..70 CDD:275380 7/27 (26%)
leucine-rich repeat 71..93 CDD:275380 5/21 (24%)
leucine-rich repeat 94..117 CDD:275380 7/22 (32%)
leucine-rich repeat 118..141 CDD:275380 4/40 (10%)
LRR_8 120..176 CDD:290566 18/73 (25%)
leucine-rich repeat 142..165 CDD:275380 9/22 (41%)
LRR_8 164..221 CDD:290566 19/62 (31%)
leucine-rich repeat 166..189 CDD:275380 9/22 (41%)
leucine-rich repeat 190..213 CDD:275380 7/28 (25%)
LRR_8 213..272 CDD:290566 14/58 (24%)
leucine-rich repeat 214..237 CDD:275380 8/22 (36%)
leucine-rich repeat 238..261 CDD:275380 2/22 (9%)
leucine-rich repeat 262..285 CDD:275380 6/22 (27%)
leucine-rich repeat 286..310 CDD:275380 6/25 (24%)
LRR_8 309..370 CDD:290566 23/107 (21%)
leucine-rich repeat 311..333 CDD:275380 6/21 (29%)
leucine-rich repeat 336..359 CDD:275378 8/69 (12%)
leucine-rich repeat 360..372 CDD:275378 5/11 (45%)
TPKR_C2 368..419 CDD:301599 5/15 (33%)
I-set 429..513 CDD:254352
IGc2 437..503 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.