| Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001102939.1 | Gene: | Lrrtm2 / 685472 | RGDID: | 1593785 | Length: | 515 | Species: | Rattus norvegicus |
| Alignment Length: | 285 | Identity: | 91/285 - (31%) |
|---|---|---|---|
| Similarity: | 146/285 - (51%) | Gaps: | 16/285 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 215 RGLH--------GLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLH 271
Fly 272 LQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPA 336
Fly 337 TFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGH 401
Fly 402 NELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFL-AKVNVSFPNL 465
Fly 466 KRVAIEGNPWQC-PCFVKLQHWLAT 489 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 13/48 (27%) |
| LRR_8 | 104..164 | CDD:290566 | |||
| leucine-rich repeat | 106..129 | CDD:275380 | |||
| leucine-rich repeat | 130..153 | CDD:275380 | |||
| leucine-rich repeat | 154..195 | CDD:275380 | |||
| LRR_RI | 194..455 | CDD:238064 | 78/247 (32%) | ||
| LRR_8 | 194..254 | CDD:290566 | 13/46 (28%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 2/11 (18%) | ||
| leucine-rich repeat | 220..243 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 244..267 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 271..330 | CDD:290566 | 25/58 (43%) | ||
| leucine-rich repeat | 272..295 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 296..319 | CDD:275380 | 12/22 (55%) | ||
| LRR_8 | 319..380 | CDD:290566 | 21/60 (35%) | ||
| leucine-rich repeat | 320..343 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 344..369 | CDD:275380 | 11/24 (46%) | ||
| LRR_8 | 368..428 | CDD:290566 | 17/59 (29%) | ||
| leucine-rich repeat | 370..393 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 394..417 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 418..441 | CDD:275380 | 9/22 (41%) | ||
| Lrrtm2 | NP_001102939.1 | LRR 1 | 61..83 | 6/21 (29%) | |
| leucine-rich repeat | 66..86 | CDD:275380 | 4/19 (21%) | ||
| LRR_RI | 73..311 | CDD:238064 | 76/243 (31%) | ||
| LRR 2 | 84..107 | 6/22 (27%) | |||
| LRR_8 | 85..145 | CDD:290566 | 21/63 (33%) | ||
| leucine-rich repeat | 87..110 | CDD:275380 | 5/22 (23%) | ||
| LRR 3 | 109..131 | 8/25 (32%) | |||
| leucine-rich repeat | 111..134 | CDD:275380 | 9/22 (41%) | ||
| LRR 4 | 132..155 | 11/22 (50%) | |||
| LRR_8 | 134..193 | CDD:290566 | 24/58 (41%) | ||
| leucine-rich repeat | 135..158 | CDD:275380 | 12/22 (55%) | ||
| LRR 5 | 156..179 | 7/22 (32%) | |||
| leucine-rich repeat | 159..182 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 181..241 | CDD:290566 | 21/61 (34%) | ||
| LRR 6 | 181..203 | 9/21 (43%) | |||
| leucine-rich repeat | 183..206 | CDD:275380 | 11/24 (46%) | ||
| LRR 7 | 205..227 | 5/21 (24%) | |||
| leucine-rich repeat | 207..230 | CDD:275380 | 6/22 (27%) | ||
| LRR 8 | 229..251 | 6/21 (29%) | |||
| leucine-rich repeat | 231..254 | CDD:275380 | 6/22 (27%) | ||
| LRR 9 | 252..275 | 8/22 (36%) | |||
| LRR_8 | 253..312 | CDD:290566 | 20/58 (34%) | ||
| leucine-rich repeat | 255..278 | CDD:275380 | 9/22 (41%) | ||
| LRR 10 | 276..299 | 7/22 (32%) | |||
| leucine-rich repeat | 279..300 | CDD:275380 | 7/20 (35%) | ||
| Involved in DLG4-binding | 512..515 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||