| Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_071426.1 | Gene: | LRRC4 / 64101 | HGNCID: | 15586 | Length: | 653 | Species: | Homo sapiens |
| Alignment Length: | 383 | Identity: | 102/383 - (26%) |
|---|---|---|---|
| Similarity: | 142/383 - (37%) | Gaps: | 102/383 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 199 LILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFG 263
Fly 264 AVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYN 328
Fly 329 AILEIKPATFAALLNLDTLDLSYNNLE---------FLEEQIFGGNTLPRMRRLNLNG-NRMKHL 383
Fly 384 HPL----------AFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLES 438
Fly 439 LSSVQEILVDNN------------RLTFLAKV-------------------NVSFPNLKRVAIEG 472
Fly 473 NP-----WQCPCFVKLQHWLATRDVVYLRD-----------NTGYYKGERPLCIVTNV 514 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 24/56 (43%) |
| LRR_8 | 104..164 | CDD:290566 | |||
| leucine-rich repeat | 106..129 | CDD:275380 | |||
| leucine-rich repeat | 130..153 | CDD:275380 | |||
| leucine-rich repeat | 154..195 | CDD:275380 | |||
| LRR_RI | 194..455 | CDD:238064 | 83/287 (29%) | ||
| LRR_8 | 194..254 | CDD:290566 | 23/54 (43%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 9/19 (47%) | ||
| leucine-rich repeat | 220..243 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 244..267 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 271..330 | CDD:290566 | 15/58 (26%) | ||
| leucine-rich repeat | 272..295 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 296..319 | CDD:275380 | 4/22 (18%) | ||
| LRR_8 | 319..380 | CDD:290566 | 20/70 (29%) | ||
| leucine-rich repeat | 320..343 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 344..369 | CDD:275380 | 9/33 (27%) | ||
| LRR_8 | 368..428 | CDD:290566 | 25/70 (36%) | ||
| leucine-rich repeat | 370..393 | CDD:275380 | 7/33 (21%) | ||
| leucine-rich repeat | 394..417 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 418..441 | CDD:275380 | 8/22 (36%) | ||
| LRRC4 | NP_071426.1 | LRRNT | 46..79 | CDD:214470 | |
| LRR | <74..291 | CDD:227223 | 71/237 (30%) | ||
| LRR 1 | 76..97 | 7/16 (44%) | |||
| leucine-rich repeat | 77..100 | CDD:275380 | 9/19 (47%) | ||
| LRR 2 | 100..121 | 7/20 (35%) | |||
| leucine-rich repeat | 101..124 | CDD:275380 | 8/22 (36%) | ||
| LRR 3 | 124..145 | 6/24 (25%) | |||
| leucine-rich repeat | 125..148 | CDD:275380 | 6/26 (23%) | ||
| LRR 4 | 148..169 | 6/20 (30%) | |||
| leucine-rich repeat | 149..172 | CDD:275380 | 6/22 (27%) | ||
| LRR 5 | 172..194 | 11/44 (25%) | |||
| leucine-rich repeat | 173..197 | CDD:275380 | 12/46 (26%) | ||
| LRR 6 | 197..218 | 5/20 (25%) | |||
| leucine-rich repeat | 198..219 | CDD:275380 | 4/20 (20%) | ||
| LRR 7 | 219..240 | 7/20 (35%) | |||
| leucine-rich repeat | 220..243 | CDD:275380 | 8/22 (36%) | ||
| LRR 8 | 243..264 | 4/20 (20%) | |||
| leucine-rich repeat | 244..267 | CDD:275380 | 5/22 (23%) | ||
| LRR 9 | 267..288 | 9/20 (45%) | |||
| leucine-rich repeat | 268..289 | CDD:275380 | 9/20 (45%) | ||
| LRRCT | 300..351 | CDD:214507 | 8/51 (16%) | ||
| IG | 359..441 | CDD:214652 | 17/76 (22%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||