| Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001365406.2 | Gene: | NYX / 60506 | HGNCID: | 8082 | Length: | 476 | Species: | Homo sapiens |
| Alignment Length: | 295 | Identity: | 85/295 - (28%) |
|---|---|---|---|
| Similarity: | 133/295 - (45%) | Gaps: | 36/295 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 221 LELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGN-RIRL 284
Fly 285 LFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDL 349
Fly 350 SYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAP 414
Fly 415 MRRLQKLHLGHNLLEEI---------NLDVL---------------ESLSSVQEILVDNNRLTFL 455
Fly 456 AKVNVSFPN--LKRVAIEGNPWQCPCFVK-LQHWL 487 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 12/34 (35%) |
| LRR_8 | 104..164 | CDD:290566 | |||
| leucine-rich repeat | 106..129 | CDD:275380 | |||
| leucine-rich repeat | 130..153 | CDD:275380 | |||
| leucine-rich repeat | 154..195 | CDD:275380 | |||
| LRR_RI | 194..455 | CDD:238064 | 72/258 (28%) | ||
| LRR_8 | 194..254 | CDD:290566 | 11/32 (34%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | |||
| leucine-rich repeat | 220..243 | CDD:275380 | 6/21 (29%) | ||
| leucine-rich repeat | 244..267 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 271..330 | CDD:290566 | 17/59 (29%) | ||
| leucine-rich repeat | 272..295 | CDD:275380 | 8/23 (35%) | ||
| leucine-rich repeat | 296..319 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 319..380 | CDD:290566 | 16/60 (27%) | ||
| leucine-rich repeat | 320..343 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 344..369 | CDD:275380 | 5/24 (21%) | ||
| LRR_8 | 368..428 | CDD:290566 | 24/59 (41%) | ||
| leucine-rich repeat | 370..393 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 394..417 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 418..441 | CDD:275380 | 9/46 (20%) | ||
| NYX | NP_001365406.2 | LRR_8 | 61..115 | CDD:404697 | 17/57 (30%) |
| leucine-rich repeat | 63..82 | CDD:275380 | 6/18 (33%) | ||
| leucine-rich repeat | 83..106 | CDD:275380 | 8/26 (31%) | ||
| leucine-rich repeat | 107..131 | CDD:275380 | 8/23 (35%) | ||
| leucine-rich repeat | 132..155 | CDD:275380 | 5/22 (23%) | ||
| PPP1R42 | 150..310 | CDD:411060 | 43/162 (27%) | ||
| leucine-rich repeat | 156..178 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 179..202 | CDD:275380 | 5/24 (21%) | ||
| leucine-rich repeat | 203..226 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 227..285 | CDD:404697 | 18/57 (32%) | ||
| leucine-rich repeat | 227..250 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 251..274 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 275..296 | CDD:275380 | 2/20 (10%) | ||
| leucine-rich repeat | 323..335 | CDD:275378 | 5/11 (45%) | ||
| LRRCT | 331..>365 | CDD:214507 | 7/16 (44%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||