| Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_065761.1 | Gene: | LRRC47 / 57470 | HGNCID: | 29207 | Length: | 583 | Species: | Homo sapiens |
| Alignment Length: | 243 | Identity: | 80/243 - (32%) |
|---|---|---|---|
| Similarity: | 114/243 - (46%) | Gaps: | 44/243 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 172 MPLLNRLEL-GHNRLVNATFGVC---PQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLS- 231
Fly 232 SIGLETFQPLAQLRKLNLSQNALDALRPNV-FGAVQNFVL-HLQQLDLSGNRIRLLFDNQFRVLA 294
Fly 295 RLQMLDVSRNSIASLSPAHFVGLGS---LRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEF 356
Fly 357 LEEQIFGGNTLPRMRRLNLNGNRM--KHLHPL--AFSSLPFLEYLKLG 400 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 29/88 (33%) |
| LRR_8 | 104..164 | CDD:290566 | |||
| leucine-rich repeat | 106..129 | CDD:275380 | |||
| leucine-rich repeat | 130..153 | CDD:275380 | |||
| leucine-rich repeat | 154..195 | CDD:275380 | 8/26 (31%) | ||
| LRR_RI | 194..455 | CDD:238064 | 72/217 (33%) | ||
| LRR_8 | 194..254 | CDD:290566 | 19/60 (32%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 220..243 | CDD:275380 | 6/23 (26%) | ||
| leucine-rich repeat | 244..267 | CDD:275380 | 12/23 (52%) | ||
| LRR_8 | 271..330 | CDD:290566 | 23/61 (38%) | ||
| leucine-rich repeat | 272..295 | CDD:275380 | 11/22 (50%) | ||
| leucine-rich repeat | 296..319 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 319..380 | CDD:290566 | 19/63 (30%) | ||
| leucine-rich repeat | 320..343 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 344..369 | CDD:275380 | 8/24 (33%) | ||
| LRR_8 | 368..428 | CDD:290566 | 11/37 (30%) | ||
| leucine-rich repeat | 370..393 | CDD:275380 | 5/26 (19%) | ||
| leucine-rich repeat | 394..417 | CDD:275380 | 5/7 (71%) | ||
| leucine-rich repeat | 418..441 | CDD:275380 | |||
| LRRC47 | NP_065761.1 | LRR | 44..>239 | CDD:227223 | 73/219 (33%) |
| leucine-rich repeat | 52..76 | CDD:275380 | 6/23 (26%) | ||
| LRR 1 | 76..95 | 9/38 (24%) | |||
| leucine-rich repeat | 77..100 | CDD:275380 | 11/47 (23%) | ||
| LRR 2 | 100..121 | 11/20 (55%) | |||
| leucine-rich repeat | 101..130 | CDD:275380 | 13/28 (46%) | ||
| LRR 3 | 130..152 | 11/21 (52%) | |||
| leucine-rich repeat | 131..154 | CDD:275380 | 11/22 (50%) | ||
| LRR 4 | 154..175 | 8/21 (38%) | |||
| leucine-rich repeat | 155..180 | CDD:275380 | 8/25 (32%) | ||
| LRR 5 | 180..202 | 6/22 (27%) | |||
| leucine-rich repeat | 181..203 | CDD:275380 | 7/22 (32%) | ||
| LRR 6 | 203..225 | 8/24 (33%) | |||
| leucine-rich repeat | 204..226 | CDD:275380 | 8/24 (33%) | ||
| LRR 7 | 226..246 | 5/19 (26%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 260..300 | 1/2 (50%) | |||
| pheT | 317..>507 | CDD:236592 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 513..544 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||