Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001071085.1 | Gene: | nyx / 568821 | ZFINID: | ZDB-GENE-061026-3 | Length: | 469 | Species: | Danio rerio |
Alignment Length: | 321 | Identity: | 90/321 - (28%) |
---|---|---|---|
Similarity: | 141/321 - (43%) | Gaps: | 50/321 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 185 LVNATFGVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNR-LSSIGLETFQPLAQLRKLN 248
Fly 249 LSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQF-------RVLARLQMLDVSRNSI 306
Fly 307 ASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMR 371
Fly 372 RLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVL 436
Fly 437 ESLSSVQEILVDNNRLTFLAKVNVSFPNLKRVAIEGNPWQCPCFVK-LQHWLAT----RDV 492 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 24/71 (34%) |
LRR_8 | 104..164 | CDD:290566 | |||
leucine-rich repeat | 106..129 | CDD:275380 | |||
leucine-rich repeat | 130..153 | CDD:275380 | |||
leucine-rich repeat | 154..195 | CDD:275380 | 3/9 (33%) | ||
LRR_RI | 194..455 | CDD:238064 | 77/268 (29%) | ||
LRR_8 | 194..254 | CDD:290566 | 20/60 (33%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 220..243 | CDD:275380 | 7/23 (30%) | ||
leucine-rich repeat | 244..267 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 271..330 | CDD:290566 | 20/65 (31%) | ||
leucine-rich repeat | 272..295 | CDD:275380 | 8/29 (28%) | ||
leucine-rich repeat | 296..319 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 319..380 | CDD:290566 | 24/60 (40%) | ||
leucine-rich repeat | 320..343 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 344..369 | CDD:275380 | 9/24 (38%) | ||
LRR_8 | 368..428 | CDD:290566 | 20/59 (34%) | ||
leucine-rich repeat | 370..393 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 394..417 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 418..441 | CDD:275380 | 7/22 (32%) | ||
nyx | NP_001071085.1 | leucine-rich repeat | 64..83 | CDD:275380 | 3/9 (33%) |
LRR_8 | 82..143 | CDD:290566 | 20/60 (33%) | ||
leucine-rich repeat | 84..107 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 108..132 | CDD:275380 | 7/23 (30%) | ||
LRR_RI | <127..311 | CDD:238064 | 61/197 (31%) | ||
leucine-rich repeat | 133..179 | CDD:275380 | 14/57 (25%) | ||
LRR_8 | 179..238 | CDD:290566 | 19/58 (33%) | ||
leucine-rich repeat | 180..203 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 204..227 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 227..286 | CDD:290566 | 22/60 (37%) | ||
leucine-rich repeat | 228..251 | CDD:275380 | 9/24 (38%) | ||
leucine-rich repeat | 252..275 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 275..333 | CDD:290566 | 15/80 (19%) | ||
leucine-rich repeat | 276..299 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 300..319 | CDD:275380 | 7/18 (39%) | ||
LRRCT | 332..>366 | CDD:214507 | 9/25 (36%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45617 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |