DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and lrrtm4l2

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_009302017.1 Gene:lrrtm4l2 / 568695 ZFINID:ZDB-GENE-080327-14 Length:557 Species:Danio rerio


Alignment Length:429 Identity:105/429 - (24%)
Similarity:164/429 - (38%) Gaps:125/429 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 TNGFSILPNLRQLNLS-GCGLVDIRGNHFAPESALQRIDFSHNQMELLDRDFFGNLRKLIYANFS 160
            :.||..:|.    |:| ||                |.:...:|.:.||....|.:|.:|::....
Zfish    45 SGGFQDVPE----NISLGC----------------QGLSLRYNSLLLLLPYQFAHLNQLVWLYLD 89

  Fly   161 HNALKQCDLPHMPLLNRLELGHNRLVNATFGVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQL 225
            ||::...|               ||                           ||:||..|.||.|
Zfish    90 HNSISTVD---------------RL---------------------------AFQGLRRLKELIL 112

  Fly   226 SGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQF 290
            |.|:::.:...||:.:..||.|:||.|.:..|.|..|..::.    ||.|.|..|.||.:....|
Zfish   113 SSNKIAQLQNGTFETVPNLRNLDLSYNQMQDLVPGHFHGLRK----LQNLHLRSNNIRSIPVRTF 173

  Fly   291 RVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLE 355
            .....|:.||:..|.:.:::...|:||..|.:|:|::|....|....|..||||..|.|.:|.: 
Zfish   174 MECRSLEFLDLGYNRLRTITRTTFLGLLRLTELHLEHNQFSRINFFLFPRLLNLQALYLQWNRI- 237

  Fly   356 FLEEQIFGGN--TLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRL 418
               ..:..|:  |...:::|:|:||.::.|.|..|..||                        .|
Zfish   238 ---RTVVQGSPWTWHTLQKLDLSGNEIQILDPAIFRCLP------------------------NL 275

  Fly   419 QKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKVNVSFPNLKRVAIEGNPWQ-----CP 478
            ..|:|..|.:..::|:|:.|..|:..|                  ||     .||.|.     ||
Zfish   276 HTLNLESNKISNVSLEVVSSWISISTI------------------NL-----AGNIWDCSSSICP 317

  Fly   479 CFVKLQHWLATRDVVYLRDNTGYYKGERPLCIVTNVDYC 517
            ....|:::..|||...:.......:|||.:..|.|...|
Zfish   318 LVSWLRNFRGTRDASIICSTPKSLQGERVMDAVRNNSVC 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 35/153 (23%)
LRR_8 104..164 CDD:290566 14/60 (23%)
leucine-rich repeat 106..129 CDD:275380 4/23 (17%)
leucine-rich repeat 130..153 CDD:275380 6/22 (27%)
leucine-rich repeat 154..195 CDD:275380 6/40 (15%)
LRR_RI 194..455 CDD:238064 69/262 (26%)
LRR_8 194..254 CDD:290566 18/59 (31%)
leucine-rich repeat 196..219 CDD:275380 4/22 (18%)
leucine-rich repeat 220..243 CDD:275380 8/22 (36%)
leucine-rich repeat 244..267 CDD:275380 9/22 (41%)
LRR_8 271..330 CDD:290566 19/58 (33%)
leucine-rich repeat 272..295 CDD:275380 8/22 (36%)
leucine-rich repeat 296..319 CDD:275380 7/22 (32%)
LRR_8 319..380 CDD:290566 19/62 (31%)
leucine-rich repeat 320..343 CDD:275380 7/22 (32%)
leucine-rich repeat 344..369 CDD:275380 6/26 (23%)
LRR_8 368..428 CDD:290566 13/59 (22%)
leucine-rich repeat 370..393 CDD:275380 8/22 (36%)
leucine-rich repeat 394..417 CDD:275380 0/22 (0%)
leucine-rich repeat 418..441 CDD:275380 7/22 (32%)
lrrtm4l2XP_009302017.1 LRR_8 <74..117 CDD:290566 18/84 (21%)
leucine-rich repeat 83..106 CDD:275380 10/64 (16%)
LRR_8 105..165 CDD:290566 22/63 (35%)
LRR_RI 107..307 CDD:238064 67/254 (26%)
leucine-rich repeat 107..130 CDD:275380 8/22 (36%)
leucine-rich repeat 131..154 CDD:275380 9/22 (41%)
LRR_8 153..213 CDD:290566 19/63 (30%)
leucine-rich repeat 155..178 CDD:275380 8/22 (36%)
leucine-rich repeat 179..202 CDD:275380 7/22 (32%)
leucine-rich repeat 203..226 CDD:275380 7/22 (32%)
LRR_8 226..285 CDD:290566 20/86 (23%)
leucine-rich repeat 227..250 CDD:275380 6/26 (23%)
leucine-rich repeat 251..274 CDD:275380 9/46 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.