DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and AgaP_AGAP007445

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_001687928.1 Gene:AgaP_AGAP007445 / 5666934 VectorBaseID:AGAP007445 Length:377 Species:Anopheles gambiae


Alignment Length:279 Identity:77/279 - (27%)
Similarity:123/279 - (44%) Gaps:32/279 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 LELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLL 285
            |||| |...|..:   |..|..|||.|.:..:|:..:...:.     ::.:||.|.:..:.:|||
Mosquito    32 LELQ-SAPALKHL---TILPNHQLRSLYIVNSAVRRIPDTIV-----YLRNLQFLGIEKSFLRLL 87

  Fly   286 FDNQFRVLARLQMLDVSRNSIASLSPAHFVG-LGSLRKLYLQYNAILEIKPATFAALLNLDTLDL 349
            ..:....|.||..|.|.||.|:.|.|.|... :.|||.|:|.||.:..:..|..|....:..|.|
Mosquito    88 DLSVLCYLPRLTTLQVLRNHISLLLPVHESSCVNSLRDLHLDYNQLTTLDIAVLAPFTAMQRLLL 152

  Fly   350 SYNNLEFL------------EEQIFGGNT----------LPRMRRLNLNGNRMKHLHPLAFSSLP 392
            .:|.:..|            |.|:..||.          ||.....||.||:.:.|..:..::||
Mosquito   153 QHNRMHSLFASQPTSFPLLQELQLGPGNNFTWIEFEQLDLPETLTANLPGNQFQQLPTIRNANLP 217

  Fly   393 FLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAK 457
            .|:.:.|..|:|.::|:......::|..:.:..|.|..:....|..|.::..|.:.:|.|...:.
Mosquito   218 NLQRIYLDGNQLSTIDLAQLQEHQQLNGVDISRNRLRTVTASELIHLPNLTSIELVDNMLESFSL 282

  Fly   458 VNVSFPNLKRVAIEGNPWQ 476
            .|.|||.|..:.::||..|
Mosquito   283 ANCSFPQLNYLYLKGNRLQ 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 13/34 (38%)
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380
LRR_RI 194..455 CDD:238064 69/256 (27%)
LRR_8 194..254 CDD:290566 12/32 (38%)
leucine-rich repeat 196..219 CDD:275380
leucine-rich repeat 220..243 CDD:275380 8/21 (38%)
leucine-rich repeat 244..267 CDD:275380 4/22 (18%)
LRR_8 271..330 CDD:290566 24/59 (41%)
leucine-rich repeat 272..295 CDD:275380 7/22 (32%)
leucine-rich repeat 296..319 CDD:275380 9/23 (39%)
LRR_8 319..380 CDD:290566 23/82 (28%)
leucine-rich repeat 320..343 CDD:275380 8/22 (36%)
leucine-rich repeat 344..369 CDD:275380 9/46 (20%)
LRR_8 368..428 CDD:290566 15/59 (25%)
leucine-rich repeat 370..393 CDD:275380 6/22 (27%)
leucine-rich repeat 394..417 CDD:275380 5/22 (23%)
leucine-rich repeat 418..441 CDD:275380 5/22 (23%)
AgaP_AGAP007445XP_001687928.1 leucine-rich repeat 51..73 CDD:275380 4/26 (15%)
leucine-rich repeat 98..122 CDD:275380 9/23 (39%)
leucine-rich repeat 123..146 CDD:275380 8/22 (36%)
leucine-rich repeat 147..170 CDD:275380 4/22 (18%)
leucine-rich repeat 171..195 CDD:275380 6/23 (26%)
leucine-rich repeat 196..218 CDD:275380 6/21 (29%)
LRR_8 217..277 CDD:290566 13/59 (22%)
leucine-rich repeat 219..242 CDD:275380 5/22 (23%)
leucine-rich repeat 243..266 CDD:275380 5/22 (23%)
leucine-rich repeat 267..289 CDD:275380 6/21 (29%)
leucine-rich repeat 290..310 CDD:275380 4/12 (33%)
leucine-rich repeat 312..338 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.