DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and AgaP_AGAP007034

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_001688068.1 Gene:AgaP_AGAP007034 / 5666908 VectorBaseID:AGAP007034 Length:416 Species:Anopheles gambiae


Alignment Length:351 Identity:72/351 - (20%)
Similarity:137/351 - (39%) Gaps:90/351 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 VFGAVQNFVLHLQQLDLSGNRIRLLFDNQFR----------------------VLARLQMLDVSR 303
            ||||..:..:...::.:.......|||:.:|                      .||  ..||..|
Mosquito    24 VFGAKLSLEMARGEIVICNYEKFHLFDSMYRPRTDNFCVFNDVYLGSDVKGADFLA--SSLDYRR 86

  Fly   304 NSIAS-----LSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFG 363
            .:.|:     :.|:.|.....:|:||::              ..:|::|.::    ..||:...|
Mosquito    87 VAFANSKFPQVPPSLFKNFDDIRELYVR--------------RCSLESLKIT----RLLEKVYAG 133

  Fly   364 GNTLP----------RMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNE-LKSLDVRMFA---- 413
            ||.:.          .:|.|.|:|||::.|..|  ::||.||.|.|.:|. |.::|...|.    
Mosquito   134 GNRIASVQLDGNASNSLRELYLDGNRLQGLANL--TNLPALEVLVLENNPLLGNVDFGQFGRMER 196

  Fly   414 --------------------PMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLA-- 456
                                |:..|::|.|.:|.|..:::.:..:...::.:.:..|||.::.  
Mosquito   197 LWKLDLERIGMSRISNGLKRPLAELRRLDLSNNALTYVHVRMFRTFPKLEHLWLHGNRLYYMEAD 261

  Fly   457 KVNVSFPNLKRVAIEGNPWQCPCFVKLQHWLATRDVVYLRDNTGYYKGERPLCIVTNVDYCIQNL 521
            :|....|:::.:.|:.|.|.|.....|...|..|.::....:....:....:|.....|  :.::
Mosquito   262 QVRTVMPSIRSIVIDDNRWGCGHLAALGKQLRDRGIIIRHGDCRAERAVHRVCCSDETD--VVDM 324

  Fly   522 QAVRRLGILGD--FQGEQVEADAFDD 545
            :.:..:||..:  ||.|..|..|.:|
Mosquito   325 RYLIEMGIRHETHFQQEVRELRAEND 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380
LRR_RI 194..455 CDD:238064 53/255 (21%)
LRR_8 194..254 CDD:290566
leucine-rich repeat 196..219 CDD:275380
leucine-rich repeat 220..243 CDD:275380
leucine-rich repeat 244..267 CDD:275380 4/5 (80%)
LRR_8 271..330 CDD:290566 15/85 (18%)
leucine-rich repeat 272..295 CDD:275380 5/44 (11%)
leucine-rich repeat 296..319 CDD:275380 6/27 (22%)
LRR_8 319..380 CDD:290566 15/70 (21%)
leucine-rich repeat 320..343 CDD:275380 3/22 (14%)
leucine-rich repeat 344..369 CDD:275380 7/34 (21%)
LRR_8 368..428 CDD:290566 23/94 (24%)
leucine-rich repeat 370..393 CDD:275380 9/22 (41%)
leucine-rich repeat 394..417 CDD:275380 9/47 (19%)
leucine-rich repeat 418..441 CDD:275380 5/22 (23%)
AgaP_AGAP007034XP_001688068.1 LRR_RI 48..263 CDD:238064 49/236 (21%)
leucine-rich repeat 108..126 CDD:275380 5/35 (14%)
leucine-rich repeat 127..149 CDD:275380 5/21 (24%)
LRR_8 149..204 CDD:290566 18/56 (32%)
leucine-rich repeat 150..171 CDD:275380 9/22 (41%)
leucine-rich repeat 172..196 CDD:275380 8/23 (35%)
leucine-rich repeat 197..220 CDD:275380 1/22 (5%)
leucine-rich repeat 221..244 CDD:275380 5/22 (23%)
DUF1640 <329..>370 CDD:285090 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.