DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and APL1C

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_001688069.1 Gene:APL1C / 5666907 VectorBaseID:AGAP007033 Length:730 Species:Anopheles gambiae


Alignment Length:480 Identity:123/480 - (25%)
Similarity:191/480 - (39%) Gaps:110/480 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 SILPNLRQ---LNLSGCGLVDIRGNHFAPESALQRIDFSHNQMELLDRDFFGNLRKLIYANFSHN 162
            ::|.:.||   |||:|..:..|..|.||....:|::....|.:..|....|.|            
Mosquito   207 ALLASFRQVEVLNLNGLQIEQIDTNAFAYAHTIQKLYMGFNAIRYLPPYVFQN------------ 259

  Fly   163 ALKQCDLPHMPLLNRLELGHNRLVNATFGV---CPQLQELILNDNQLIQLDVNAFRGLHGLLELQ 224
                     :|||..|.|..|.|.:...|:   .|:|..|.:::|.|.:::.:.|:....|..||
Mosquito   260 ---------VPLLTVLVLERNDLTSLPRGIFHNTPKLSMLSMSNNNLERIEDDTFQATTALQNLQ 315

  Fly   225 LSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQ 289
            ||.|||:.:.|..   :..|..:|:|.|.|..|                                
Mosquito   316 LSSNRLTHVDLSL---IPSLFHVNVSYNLLSTL-------------------------------- 345

  Fly   290 FRVLARLQMLDVSRNSI-ASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLN---LDTLDLS 350
             .:...::.||.|.||| |...|.:.    .|..|.||:|.:.:.     |.|||   |..:|||
Mosquito   346 -AIPIAVEELDASHNSINAVRGPVNV----ELTILKLQHNNLTDT-----AWLLNYPGLVDVDLS 400

  Fly   351 YNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAP- 414
            ||.||.:..|.|  ..:.|:.||.::.|.:..|: |....:|.|:.|.|.||.|  |.|....| 
Mosquito   401 YNQLEKITYQHF--VKMQRLERLYVSNNHLVALN-LYSQPIPTLKVLDLSHNHL--LHVERNQPQ 460

  Fly   415 MRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDN----NRLTFLAKVNVSFPNLKRVAIEGNPW 475
            ..|::.|:|.||.:..:.|....:|.::  .|..|    |.|..|      |.|:...|:.....
Mosquito   461 FDRVEYLYLDHNSIVTLKLSTSHTLKNL--TLSHNDWDCNSLRAL------FRNVAHPAVHDADQ 517

  Fly   476 QCPCFVKLQHWLATRD---------VVYLRDNTGYYKGERP--LCIVTNVDYCIQNLQAVRRLGI 529
            .|....:|:..|..::         :.|:...:...|.:|.  .|..|:....:|:|.  ..:..
Mosquito   518 HCKIDYQLEQGLCCKESDKPYLDRLLQYIALTSVVEKLQRAQGRCSATDTINSVQSLS--HYITQ 580

  Fly   530 LGD--FQG-EQVEADAFDDDASAAQ 551
            .||  .|| ||:||:..:..|...|
Mosquito   581 QGDVPLQGNEQLEAEVNELRAEVQQ 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 44/158 (28%)
LRR_8 104..164 CDD:290566 15/62 (24%)
leucine-rich repeat 106..129 CDD:275380 10/25 (40%)
leucine-rich repeat 130..153 CDD:275380 5/22 (23%)
leucine-rich repeat 154..195 CDD:275380 8/43 (19%)
LRR_RI 194..455 CDD:238064 75/269 (28%)
LRR_8 194..254 CDD:290566 19/59 (32%)
leucine-rich repeat 196..219 CDD:275380 5/22 (23%)
leucine-rich repeat 220..243 CDD:275380 9/22 (41%)
leucine-rich repeat 244..267 CDD:275380 6/22 (27%)
LRR_8 271..330 CDD:290566 13/59 (22%)
leucine-rich repeat 272..295 CDD:275380 0/22 (0%)
leucine-rich repeat 296..319 CDD:275380 8/23 (35%)
LRR_8 319..380 CDD:290566 23/63 (37%)
leucine-rich repeat 320..343 CDD:275380 7/22 (32%)
leucine-rich repeat 344..369 CDD:275380 10/24 (42%)
LRR_8 368..428 CDD:290566 21/60 (35%)
leucine-rich repeat 370..393 CDD:275380 5/22 (23%)
leucine-rich repeat 394..417 CDD:275380 9/23 (39%)
leucine-rich repeat 418..441 CDD:275380 6/22 (27%)
APL1CXP_001688069.1 LRR_8 213..273 CDD:290566 21/80 (26%)
leucine-rich repeat 215..238 CDD:275380 8/22 (36%)
leucine-rich repeat 239..262 CDD:275380 5/43 (12%)
LRR_RI 255..503 CDD:238064 85/320 (27%)
LRR_8 261..321 CDD:290566 20/59 (34%)
leucine-rich repeat 263..286 CDD:275380 6/22 (27%)
leucine-rich repeat 287..310 CDD:275380 5/22 (23%)
LRR_8 311..361 CDD:290566 19/85 (22%)
leucine-rich repeat 311..343 CDD:275380 13/34 (38%)
leucine-rich repeat 351..369 CDD:275380 8/17 (47%)
LRR_8 371..428 CDD:290566 23/63 (37%)
leucine-rich repeat 372..393 CDD:275380 9/25 (36%)
leucine-rich repeat 394..417 CDD:275380 10/24 (42%)
LRR_8 417..474 CDD:290566 21/59 (36%)
leucine-rich repeat 418..440 CDD:275380 5/22 (23%)
leucine-rich repeat 464..487 CDD:275380 6/22 (27%)
RILP-like <659..>720 CDD:304877
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.