DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and APL1A

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_001688066.1 Gene:APL1A / 5666905 VectorBaseID:AGAP007036 Length:428 Species:Anopheles gambiae


Alignment Length:401 Identity:110/401 - (27%)
Similarity:160/401 - (39%) Gaps:96/401 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LPNLRQ---LNLSGCGLVDIRGNHFAPESALQRIDFSHNQMELLDRDFFGNLRKLIYANFSHNAL 164
            |.:.||   |||:|..:.:|..|.||....:|::....|.:..|....|.|:             
Mosquito   108 LASFRQVEVLNLNGLQIEEIDTNAFAYAHTIQKLYMGFNAIRYLPPHVFQNV------------- 159

  Fly   165 KQCDLPHMPLLNRLELGHNRLVNATFGVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNR 229
                                         |.|..|:|..|.|..|....|.....|..|.:|.|.
Mosquito   160 -----------------------------PSLTVLVLERNDLTSLPRGIFHNTPKLTMLSMSNNN 195

  Fly   230 LSSIGLETFQPLAQLRKLNLSQNALD----ALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQF 290
            |..|..||||....|:.|.||.|.|.    ||.|::|           .:::|.|.:..|     
Mosquito   196 LERIEDETFQATTTLQNLQLSSNRLTHVDLALIPSLF-----------HVNVSYNLLSTL----- 244

  Fly   291 RVLARLQMLDVSRNSI-ASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLN---LDTLDLSY 351
            .:...::.||.|.||| |...|.:.    .|..|.||:|.:.:.     |.|||   |..:||||
Mosquito   245 AIPIAVEELDASHNSINAVRGPVNM----ELTILKLQHNNLTDT-----AWLLNYPGLVEVDLSY 300

  Fly   352 NNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAP-M 415
            |.||.:..:.|  ..:.|:.||.::.||:..|: |....:|.|:.|.|.||.|  |.|....| .
Mosquito   301 NELEKIMYRYF--VKMQRLERLYVSNNRLVALN-LYGQPIPTLKVLDLSHNHL--LHVERNQPQF 360

  Fly   416 RRLQKLHLGHNLLEEINLDVLESLSSVQEILVDN----NRLTFLAKVNVSFPNLKRVAIEGNPWQ 476
            .||:.|:|.||.:..:||....:|.:::  |..|    |.|..|      |.|:.:..::.....
Mosquito   361 DRLENLYLDHNSIVTLNLSTSHTLKNLK--LSHNDWDCNSLRAL------FINVAQPVVDDADQH 417

  Fly   477 CPCFVKLQHWL 487
            |....:|:|.|
Mosquito   418 CKIDYQLEHGL 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 40/159 (25%)
LRR_8 104..164 CDD:290566 15/62 (24%)
leucine-rich repeat 106..129 CDD:275380 10/25 (40%)
leucine-rich repeat 130..153 CDD:275380 5/22 (23%)
leucine-rich repeat 154..195 CDD:275380 0/40 (0%)
LRR_RI 194..455 CDD:238064 87/273 (32%)
LRR_8 194..254 CDD:290566 23/59 (39%)
leucine-rich repeat 196..219 CDD:275380 7/22 (32%)
leucine-rich repeat 220..243 CDD:275380 10/22 (45%)
leucine-rich repeat 244..267 CDD:275380 10/26 (38%)
LRR_8 271..330 CDD:290566 16/59 (27%)
leucine-rich repeat 272..295 CDD:275380 3/22 (14%)
leucine-rich repeat 296..319 CDD:275380 8/23 (35%)
LRR_8 319..380 CDD:290566 22/63 (35%)
leucine-rich repeat 320..343 CDD:275380 7/22 (32%)
leucine-rich repeat 344..369 CDD:275380 9/24 (38%)
LRR_8 368..428 CDD:290566 23/60 (38%)
leucine-rich repeat 370..393 CDD:275380 6/22 (27%)
leucine-rich repeat 394..417 CDD:275380 9/23 (39%)
leucine-rich repeat 418..441 CDD:275380 8/22 (36%)
APL1AXP_001688066.1 LRR_8 112..172 CDD:290566 20/101 (20%)
leucine-rich repeat 114..137 CDD:275380 8/22 (36%)
leucine-rich repeat 138..161 CDD:275380 5/64 (8%)
LRR_RI 160..402 CDD:238064 87/273 (32%)
LRR_8 160..220 CDD:290566 23/59 (39%)
leucine-rich repeat 162..185 CDD:275380 7/22 (32%)
leucine-rich repeat 186..209 CDD:275380 10/22 (45%)
leucine-rich repeat 210..230 CDD:275380 8/19 (42%)
leucine-rich repeat 231..255 CDD:275380 5/39 (13%)
LRR_8 270..327 CDD:290566 22/63 (35%)
leucine-rich repeat 271..292 CDD:275380 9/25 (36%)
leucine-rich repeat 293..316 CDD:275380 9/24 (38%)
LRR_8 316..373 CDD:290566 23/59 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.