DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and AgaP_AGAP007456

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_001687922.1 Gene:AgaP_AGAP007456 / 5666886 VectorBaseID:AGAP007456 Length:542 Species:Anopheles gambiae


Alignment Length:407 Identity:88/407 - (21%)
Similarity:160/407 - (39%) Gaps:98/407 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 ANLLDLDLTGAAPINVHTNGFSILPNLRQLNLSGCGLVDIRGNHFAPESALQRIDFSHN------ 138
            |..|..|:......|:....|||     .::.....:||    .|.|       ||:..      
Mosquito    37 ATCLVRDVILGTVANIEDASFSI-----DMHYVALTMVD----GFIP-------DFTRQLARQFP 85

  Fly   139 QMELLDRDFFGNLRKLIYANFS-----HNALKQCDLPHMPLLNRLELGHNRLVNATFGVCPQLQE 198
            |::.|..|..|..:..|::|..     :|:::..|.                  |:.||..:|:.
Mosquito    86 QVQDLTVDAMGIRKMYIWSNLEQLSARNNSIRALDF------------------ASIGVEHRLRS 132

  Fly   199 LILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRP---- 259
            |.|:||:|..:.:.. :..:.|..|.|.||||..:.|::|..|.||:.|:|::|.|..:..    
Mosquito   133 LRLDDNELSSVPLFG-KSFNELKYLSLEGNRLEEVALDSFTGLGQLQSLSLARNGLIVVESTTRA 196

  Fly   260 ---NVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSI-ASLSPAHFVGLGSL 320
               ::...||  :|.|:.|.|:.||:..:..:.:. :..|..||:|.|.: ..|..||.:|    
Mosquito   197 PARSIHQGVQ--LLKLKHLSLASNRLITVNISGWE-MPSLVSLDLSNNDLYLLLDEAHQLG---- 254

  Fly   321 RKLYLQYNAILEIKPA---TFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLN-------- 374
                 |:.|:||:..|   .....|:...|.|....:...::.........:|:.||        
Mosquito   255 -----QFGALLEVSYAGNDWQCGWLSEAQLMLRKRGIAVKDQDPAARCDREQMKSLNGICCYERA 314

  Fly   375 ----LN-----GNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEE 430
                ||     |:|.:.|:.|...    .|.::..:::::..|:.:..        ..||:|..:
Mosquito   315 LDQELNDKDPFGSRWEQLNELRRR----YELVQYSYDQVEDADLNLIT--------ERGHDLRAK 367

  Fly   431 INLDVLESLSSVQEILV 447
            :...|.:....::..||
Mosquito   368 LMGSVAQDQDEIKRELV 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 39/163 (24%)
LRR_8 104..164 CDD:290566 13/70 (19%)
leucine-rich repeat 106..129 CDD:275380 4/22 (18%)
leucine-rich repeat 130..153 CDD:275380 6/28 (21%)
leucine-rich repeat 154..195 CDD:275380 7/45 (16%)
LRR_RI 194..455 CDD:238064 64/282 (23%)
LRR_8 194..254 CDD:290566 21/59 (36%)
leucine-rich repeat 196..219 CDD:275380 6/22 (27%)
leucine-rich repeat 220..243 CDD:275380 10/22 (45%)
leucine-rich repeat 244..267 CDD:275380 6/29 (21%)
LRR_8 271..330 CDD:290566 15/59 (25%)
leucine-rich repeat 272..295 CDD:275380 5/22 (23%)
leucine-rich repeat 296..319 CDD:275380 9/23 (39%)
LRR_8 319..380 CDD:290566 14/80 (18%)
leucine-rich repeat 320..343 CDD:275380 5/25 (20%)
leucine-rich repeat 344..369 CDD:275380 2/24 (8%)
LRR_8 368..428 CDD:290566 13/76 (17%)
leucine-rich repeat 370..393 CDD:275380 9/39 (23%)
leucine-rich repeat 394..417 CDD:275380 2/22 (9%)
leucine-rich repeat 418..441 CDD:275380 4/22 (18%)
AgaP_AGAP007456XP_001687922.1 leucine-rich repeat 106..129 CDD:275380 5/40 (13%)
LRR_8 129..187 CDD:290566 21/58 (36%)
LRR_4 129..166 CDD:289563 13/37 (35%)
leucine-rich repeat 130..152 CDD:275380 6/22 (27%)
leucine-rich repeat 153..176 CDD:275380 10/22 (45%)
LRR_8 176..243 CDD:290566 19/69 (28%)
leucine-rich repeat 177..209 CDD:275380 7/33 (21%)
leucine-rich repeat 210..232 CDD:275380 5/22 (23%)
MIT_CorA-like <347..>418 CDD:294313 7/46 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.