DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and AgaP_AGAP007463

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_001687919.1 Gene:AgaP_AGAP007463 / 5666876 VectorBaseID:AGAP007463 Length:400 Species:Anopheles gambiae


Alignment Length:303 Identity:78/303 - (25%)
Similarity:132/303 - (43%) Gaps:45/303 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 NRLVNATFGVCPQLQELILNDN-QLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRK 246
            |.:.....|..|.::..|...| .|..||::           :.|.:|:.    :|...:.:|:.
Mosquito    61 NTISGIIIGYAPGMRTFIAGSNTHLESLDIS-----------KCSLDRVP----QTLPKMTKLKF 110

  Fly   247 LNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLLF---DNQFRVLARLQMLDVSRNSIAS 308
            |:::|..:..||.::|...|    :|:.||||.|:|:.|.   ....|:|: ::.|.:..|.:.:
Mosquito   111 LSITQCKITVLRLDMFADNQ----YLKNLDLSYNQIQQLLPVTGRPARMLS-IETLTLRGNLLQN 170

  Fly   309 LSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRL 373
            |..|.||.:..|..|....|.|:.:..:...||.||..|.|.||.|..|:   ....|||::...
Mosquito   171 LDLALFVAMPQLLNLNFLNNLIVSLDVSAPIALPNLSGLYLGYNKLVSLD---LRNLTLPKLETF 232

  Fly   374 NLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLE--------E 430
            :...|.:..: |:....||...||.|..|.|..||:..|.|...|||:::..|.:.        .
Mosquito   233 SFGPNALTQM-PILPRPLPKFNYLSLSANNLTQLDMTYFRPYPNLQKIYISSNQITTVRASSPVR 296

  Fly   431 INLDVLESLSSVQEILVDNNRLTFLAKVNVSFPNLKRVAIEGN 473
            :.:|.||         :.||::|.........||:..:.::||
Mosquito   297 LQVDYLE---------LSNNKITTFNITGWDMPNITLLNLDGN 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 14/73 (19%)
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380 2/11 (18%)
LRR_RI 194..455 CDD:238064 72/272 (26%)
LRR_8 194..254 CDD:290566 12/60 (20%)
leucine-rich repeat 196..219 CDD:275380 5/23 (22%)
leucine-rich repeat 220..243 CDD:275380 3/22 (14%)
leucine-rich repeat 244..267 CDD:275380 6/22 (27%)
LRR_8 271..330 CDD:290566 19/61 (31%)
leucine-rich repeat 272..295 CDD:275380 10/25 (40%)
leucine-rich repeat 296..319 CDD:275380 6/22 (27%)
LRR_8 319..380 CDD:290566 18/60 (30%)
leucine-rich repeat 320..343 CDD:275380 6/22 (27%)
leucine-rich repeat 344..369 CDD:275380 9/24 (38%)
LRR_8 368..428 CDD:290566 18/59 (31%)
leucine-rich repeat 370..393 CDD:275380 3/22 (14%)
leucine-rich repeat 394..417 CDD:275380 9/22 (41%)
leucine-rich repeat 418..441 CDD:275380 7/30 (23%)
AgaP_AGAP007463XP_001687919.1 leucine-rich repeat 85..107 CDD:275380 6/36 (17%)
LRR_RI 87..>328 CDD:238064 70/273 (26%)
LRR_8 106..168 CDD:290566 19/66 (29%)
leucine-rich repeat 108..131 CDD:275380 7/26 (27%)
leucine-rich repeat 132..155 CDD:275380 8/22 (36%)
leucine-rich repeat 156..181 CDD:275380 7/25 (28%)
leucine-rich repeat 182..205 CDD:275380 6/22 (27%)
LRR_8 204..286 CDD:290566 28/85 (33%)
leucine-rich repeat 206..228 CDD:275380 9/24 (38%)
leucine-rich repeat 229..251 CDD:275380 3/22 (14%)
leucine-rich repeat 252..275 CDD:275380 9/22 (41%)
LRR_8 274..332 CDD:290566 14/66 (21%)
leucine-rich repeat 276..296 CDD:275380 4/19 (21%)
leucine-rich repeat 322..341 CDD:275380 2/9 (22%)
leucine-rich repeat 345..356 CDD:275378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.