Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005166545.1 | Gene: | lrrc4cb / 564462 | ZFINID: | ZDB-GENE-080327-5 | Length: | 631 | Species: | Danio rerio |
Alignment Length: | 329 | Identity: | 86/329 - (26%) |
---|---|---|---|
Similarity: | 135/329 - (41%) | Gaps: | 76/329 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 191 GVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALD 255
Fly 256 ALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSL 320
Fly 321 RKLYL-QYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLH 384
Fly 385 PLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDN 449
Fly 450 NRLTFLA-KVNVSFPNLKRVAIEGNPWQCPCFVKLQHWLATRDVVYLRDNTGYYKGERPLCIVTN 513
Fly 514 VDYC 517 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 24/64 (38%) |
LRR_8 | 104..164 | CDD:290566 | |||
leucine-rich repeat | 106..129 | CDD:275380 | |||
leucine-rich repeat | 130..153 | CDD:275380 | |||
leucine-rich repeat | 154..195 | CDD:275380 | 2/3 (67%) | ||
LRR_RI | 194..455 | CDD:238064 | 68/261 (26%) | ||
LRR_8 | 194..254 | CDD:290566 | 21/59 (36%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 220..243 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 244..267 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 271..330 | CDD:290566 | 14/59 (24%) | ||
leucine-rich repeat | 272..295 | CDD:275380 | 2/22 (9%) | ||
leucine-rich repeat | 296..319 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 319..380 | CDD:290566 | 19/61 (31%) | ||
leucine-rich repeat | 320..343 | CDD:275380 | 7/23 (30%) | ||
leucine-rich repeat | 344..369 | CDD:275380 | 6/24 (25%) | ||
LRR_8 | 368..428 | CDD:290566 | 15/59 (25%) | ||
leucine-rich repeat | 370..393 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 394..417 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 418..441 | CDD:275380 | 4/22 (18%) | ||
lrrc4cb | XP_005166545.1 | LRRNT | 48..81 | CDD:214470 | 2/6 (33%) |
LRR_8 | 77..137 | CDD:290566 | 21/59 (36%) | ||
leucine-rich repeat | 79..102 | CDD:275380 | 8/22 (36%) | ||
LRR_RI | 82..>281 | CDD:238064 | 66/254 (26%) | ||
leucine-rich repeat | 103..126 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 125..180 | CDD:290566 | 22/82 (27%) | ||
leucine-rich repeat | 127..150 | CDD:275380 | 11/50 (22%) | ||
leucine-rich repeat | 151..174 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 175..199 | CDD:275380 | 7/23 (30%) | ||
leucine-rich repeat | 200..221 | CDD:275380 | 6/24 (25%) | ||
LRR_8 | 221..280 | CDD:290566 | 16/82 (20%) | ||
leucine-rich repeat | 222..245 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 246..269 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 270..291 | CDD:275380 | 9/44 (20%) | ||
LRRCT | 302..352 | CDD:214507 | 11/45 (24%) | ||
I-set | 355..443 | CDD:254352 | |||
Ig | 372..439 | CDD:143165 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |