DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and zgc:153913

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001073448.1 Gene:zgc:153913 / 559700 ZFINID:ZDB-GENE-061103-397 Length:496 Species:Danio rerio


Alignment Length:407 Identity:113/407 - (27%)
Similarity:170/407 - (41%) Gaps:64/407 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 DLTGAAPINVHTNGFSILPNLRQLNLSGCGLVDIRGNHFAPESALQRIDFSHNQMELLDRDFFGN 150
            |...:.|:|:.|       .:|:|.:...|:.|:....|.....|.::.|.:..::.:..:.|..
Zfish    38 DRMKSLPVNIST-------QVRELIVVASGIPDLDQQSFPETLRLSKLVFLNGMLKSVSGEAFER 95

  Fly   151 LRKLIYANFSHNALKQCDLPHMPLLNRLELGHN----RLVNATFGVCPQLQELILNDNQLIQLDV 211
            |.:                     |..||:..|    .|...||.....|..|:||:|:|..:|.
Zfish    96 LVE---------------------LRELEISGNICWMSLDIQTFSSLTNLTRLLLNNNKLSGVDA 139

  Fly   212 NAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLD 276
            ..|..||.|..|||.||.||.:....||.|.:|::|:||.|.:.:|...:|   || ...|:.|.
Zfish   140 GLFHSLHQLEMLQLRGNGLSFLSGRLFQRLHRLQELDLSFNQISSLSTELF---QN-NSELRVLS 200

  Fly   277 LSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAAL 341
            |..|:|..|.|..|..|..||.|::..|.|..|:|..|.  .||:.|.|:.|.:.::..|.|..|
Zfish   201 LQANKIPNLPDGIFTHLDHLQELNLRSNLIRVLTPGSFP--ASLKTLILKKNLLEKLTNAVFHTL 263

  Fly   342 LNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKS 406
            ..:..||||.|:|..:...:|  ..|..:..|:|:.||:..|....|..|..::.:.|..|.|.|
Zfish   264 HYITYLDLSQNSLTEVPADLF--QNLISLETLDLSENRISTLAGSVFKGLFSIKSVYLQKNSLIS 326

  Fly   407 LDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKVNVSFPNLKRVAIE 471
            :|..:......||.|.|.:|.|..|.....|.|         :.:..|              .:.
Zfish   327 VDAHLLKDQHDLQLLDLSNNSLRSIPSGFFEDL---------DFQCVF--------------ELR 368

  Fly   472 GNPWQCPCFVK-LQHWL 487
            ||||.|.|.:. ...||
Zfish   369 GNPWSCDCGIHYFYDWL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 42/156 (27%)
LRR_8 104..164 CDD:290566 9/59 (15%)
leucine-rich repeat 106..129 CDD:275380 5/22 (23%)
leucine-rich repeat 130..153 CDD:275380 4/22 (18%)
leucine-rich repeat 154..195 CDD:275380 7/44 (16%)
LRR_RI 194..455 CDD:238064 84/260 (32%)
LRR_8 194..254 CDD:290566 26/59 (44%)
leucine-rich repeat 196..219 CDD:275380 9/22 (41%)
leucine-rich repeat 220..243 CDD:275380 11/22 (50%)
leucine-rich repeat 244..267 CDD:275380 7/22 (32%)
LRR_8 271..330 CDD:290566 22/58 (38%)
leucine-rich repeat 272..295 CDD:275380 9/22 (41%)
leucine-rich repeat 296..319 CDD:275380 8/22 (36%)
LRR_8 319..380 CDD:290566 19/60 (32%)
leucine-rich repeat 320..343 CDD:275380 7/22 (32%)
leucine-rich repeat 344..369 CDD:275380 8/24 (33%)
LRR_8 368..428 CDD:290566 17/59 (29%)
leucine-rich repeat 370..393 CDD:275380 7/22 (32%)
leucine-rich repeat 394..417 CDD:275380 5/22 (23%)
leucine-rich repeat 418..441 CDD:275380 9/22 (41%)
zgc:153913NP_001073448.1 leucine-rich repeat 75..98 CDD:275380 4/22 (18%)
LRR_RI 141..>350 CDD:238064 74/216 (34%)
LRR_8 147..206 CDD:290566 24/62 (39%)
leucine-rich repeat 148..171 CDD:275380 11/22 (50%)
leucine-rich repeat 172..195 CDD:275380 9/26 (35%)
LRR_8 194..252 CDD:290566 22/59 (37%)
leucine-rich repeat 196..219 CDD:275380 9/22 (41%)
leucine-rich repeat 220..241 CDD:275380 8/22 (36%)
leucine-rich repeat 242..265 CDD:275380 7/22 (32%)
leucine-rich repeat 266..289 CDD:275380 8/24 (33%)
LRR_8 267..324 CDD:290566 17/58 (29%)
leucine-rich repeat 290..313 CDD:275380 7/22 (32%)
leucine-rich repeat 314..337 CDD:275380 5/22 (23%)
leucine-rich repeat 338..359 CDD:275380 8/20 (40%)
TPKR_C2 370..>404 CDD:301599 7/16 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.