DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and lrrk2

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_009296472.2 Gene:lrrk2 / 559366 ZFINID:ZDB-GENE-071218-6 Length:2660 Species:Danio rerio


Alignment Length:497 Identity:121/497 - (24%)
Similarity:192/497 - (38%) Gaps:149/497 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 AAPINVHTN-------GFS-------ILPN--LRQLNLSG-------CGLVDIRGNHFAPESALQ 131
            :.|:..|.|       |||       :|..  :|.|:|||       | |.|:.......|: |.
Zfish   968 SVPVQKHANSHNIRGQGFSESFSSPVVLDKDPVRLLDLSGNELNDLSC-LTDLNSLKKLIEN-LH 1030

  Fly   132 RIDFSHNQMELLDRDFFGNLRKLIYANFSHNALKQC---DLPHMPLLNRLELGHN---RLVNATF 190
            |:|.|.|.:.........:||.|...:...|.| ||   :|..:|.|:.|.:..|   .|:....
Zfish  1031 RLDLSGNNLSQFPSILCQSLRSLTRLDLQGNHL-QCLPSELLSLPALHTLNVSRNCIGPLLQLEP 1094

  Fly   191 GVC-PQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNAL 254
            ||| |.|:.|.|:.||:.............|.||.|.||::|.:.|    ||.            
Zfish  1095 GVCSPALRRLNLSFNQITVCPFQLRSATQRLEELSLEGNQISELSL----PLC------------ 1143

  Fly   255 DALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGS 319
                          :..|:.||:|.|:::::.||......:::....|.|.|:||  .|.     
Zfish  1144 --------------LAELKVLDVSKNQVKIVSDNFLAECLKMETFIASVNQISSL--PHL----- 1187

  Fly   320 LRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHL- 383
                           |:      .:.|:.||:|....:.|.:.   .||.:|.:::..|.:..| 
Zfish  1188 ---------------PS------KITTVKLSHNTFTRVPEIVI---NLPCLRSVDMRNNSVGVLP 1228

  Fly   384 HPLAFSSLPFLEYLKLGHNELKSLDVRMFAPM---RRLQKLHLGHNLLEEI--NLDVLESLSSVQ 443
            .|..:.|:...| |...||.:.:||  :..|:   .||:||||..|.|.||  .:.:||.|:|:.
Zfish  1229 GPSVWLSVNLRE-LMFSHNLISALD--LSGPVYKWARLEKLHLSFNRLTEIPPQIGMLEDLTSLD 1290

  Fly   444 EILVDNNRLTFLAKVNVSFP-------NLKRVAIEGNPWQCPCFVKLQH-WLATRDVV-----YL 495
              :..|..|.       |||       :|..:.::|...|    :.|:| ...|:|::     .|
Zfish  1291 --VSHNEGLR-------SFPDEMGKLVHLWDLPLDGLQLQ----LDLKHIGSKTKDIIRFLQQRL 1342

  Fly   496 RDNTGYYK-----------GERPLCIVTNVDYCIQNLQAVRR 526
            :....|::           |:..|         ||.|..:||
Zfish  1343 KKAVPYHRMKLMVLGGSGSGKSSL---------IQQLMRLRR 1375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 47/168 (28%)
LRR_8 104..164 CDD:290566 18/68 (26%)
leucine-rich repeat 106..129 CDD:275380 9/29 (31%)
leucine-rich repeat 130..153 CDD:275380 6/22 (27%)
leucine-rich repeat 154..195 CDD:275380 14/47 (30%)
LRR_RI 194..455 CDD:238064 65/266 (24%)
LRR_8 194..254 CDD:290566 16/59 (27%)
leucine-rich repeat 196..219 CDD:275380 5/22 (23%)
leucine-rich repeat 220..243 CDD:275380 10/22 (45%)
leucine-rich repeat 244..267 CDD:275380 0/22 (0%)
LRR_8 271..330 CDD:290566 13/58 (22%)
leucine-rich repeat 272..295 CDD:275380 7/22 (32%)
leucine-rich repeat 296..319 CDD:275380 6/22 (27%)
LRR_8 319..380 CDD:290566 10/60 (17%)
leucine-rich repeat 320..343 CDD:275380 1/22 (5%)
leucine-rich repeat 344..369 CDD:275380 6/24 (25%)
LRR_8 368..428 CDD:290566 20/63 (32%)
leucine-rich repeat 370..393 CDD:275380 5/23 (22%)
leucine-rich repeat 394..417 CDD:275380 7/25 (28%)
leucine-rich repeat 418..441 CDD:275380 12/24 (50%)
lrrk2XP_009296472.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.