DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and si:ch211-237i5.4

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_001920877.1 Gene:si:ch211-237i5.4 / 557635 ZFINID:ZDB-GENE-131121-468 Length:346 Species:Danio rerio


Alignment Length:309 Identity:91/309 - (29%)
Similarity:130/309 - (42%) Gaps:69/309 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 VCPQLQELILN-------DNQLIQLDVNAF----RGL-HGLLELQLSGNRLSSIGLETFQPLAQL 244
            :||.....:.:       .:.|:......|    .|| ||...|.|.||||:.|....|..|..|
Zfish    12 LCPSRSSRLCSHLCQCYEHSDLVDCHARGFEDVPHGLPHGTWLLDLGGNRLTEIRSRAFAGLWSL 76

  Fly   245 RKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASL 309
            |.|.||.:.:.||:...|.:                            |:.|:.||:|.|::..:
Zfish    77 RILVLSDSNIQALQSQAFFS----------------------------LSFLEKLDMSHNNLTQI 113

  Fly   310 SPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLN 374
            .|.....|.|||:|.|.:||:..:||.....|.||..||||:|:::.||...|.|  |.|:|.|.
Zfish   114 PPNFSESLSSLRELRLDHNALQLLKPPGLEHLENLAKLDLSHNHIQSLEPGAFRG--LSRLRHLY 176

  Fly   375 LNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESL 439
            |.||.:..:...:.:.||.||.|:||:|.:..::|...||:..|..|.|..|.||.:|.....||
Zfish   177 LQGNHLDVIRDRSLTMLPALEVLQLGNNNISQIEVNALAPLHSLSLLGLEGNQLEHLNFKTFLSL 241

  Fly   440 SSVQEILVDNNRLTFLAKVNVSFPNLKRVAIEGNPWQCPC-----FVKL 483
            .:....|:                      :.||||.|.|     |.||
Zfish   242 RTATTHLL----------------------LSGNPWSCDCDLHRVFSKL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 22/75 (29%)
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380 1/2 (50%)
LRR_RI 194..455 CDD:238064 81/272 (30%)
LRR_8 194..254 CDD:290566 21/71 (30%)
leucine-rich repeat 196..219 CDD:275380 4/34 (12%)
leucine-rich repeat 220..243 CDD:275380 9/22 (41%)
leucine-rich repeat 244..267 CDD:275380 8/22 (36%)
LRR_8 271..330 CDD:290566 14/58 (24%)
leucine-rich repeat 272..295 CDD:275380 1/22 (5%)
leucine-rich repeat 296..319 CDD:275380 7/22 (32%)
LRR_8 319..380 CDD:290566 28/60 (47%)
leucine-rich repeat 320..343 CDD:275380 9/22 (41%)
leucine-rich repeat 344..369 CDD:275380 11/24 (46%)
LRR_8 368..428 CDD:290566 21/59 (36%)
leucine-rich repeat 370..393 CDD:275380 6/22 (27%)
leucine-rich repeat 394..417 CDD:275380 9/22 (41%)
leucine-rich repeat 418..441 CDD:275380 9/22 (41%)
si:ch211-237i5.4XP_001920877.1 leucine-rich repeat 34..53 CDD:275380 5/18 (28%)
leucine-rich repeat 54..75 CDD:275380 9/20 (45%)
LRR_RI <69..238 CDD:238064 64/198 (32%)
LRR_8 75..134 CDD:290566 22/86 (26%)
leucine-rich repeat 76..99 CDD:275380 9/50 (18%)
leucine-rich repeat 100..123 CDD:275380 7/22 (32%)
LRR_8 122..182 CDD:290566 28/61 (46%)
leucine-rich repeat 124..147 CDD:275380 9/22 (41%)
leucine-rich repeat 148..171 CDD:275380 11/24 (46%)
LRR_8 170..230 CDD:290566 21/59 (36%)
leucine-rich repeat 172..195 CDD:275380 6/22 (27%)
leucine-rich repeat 196..219 CDD:275380 9/22 (41%)
leucine-rich repeat 220..240 CDD:275380 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.