DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and vasna

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001313614.1 Gene:vasna / 553185 ZFINID:ZDB-GENE-050522-43 Length:688 Species:Danio rerio


Alignment Length:344 Identity:101/344 - (29%)
Similarity:145/344 - (42%) Gaps:81/344 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 INV-HTNGFSILPNLRQLNLSGCGLVDIRGNHFAPESALQRIDFSHNQMELLDRDFFGNLRKLIY 156
            ||: ....|..|..|..|:||...|.:|....|:|.|:|..:|.|.|.:..:.:|.|        
Zfish    64 INILQQQDFVELGELEMLDLSQNSLSEIPDGVFSPLSSLHNLDLSSNYITHISKDSF-------- 120

  Fly   157 ANFSHNALKQCDLPHMPLLNRLELGHNRLVNATFGVCPQLQELILNDNQLIQLDVNAFRGLHGLL 221
                                   :|   |||        |:.|.|..|.:..:...||.||..||
Zfish   121 -----------------------IG---LVN--------LERLYLYSNIIQNIHPAAFEGLENLL 151

  Fly   222 ELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLLF 286
            ||:|.||::|.  |...| |.:|..|:||.|::.   |.|...:|  ..||:.|.::|..:..|.
Zfish   152 ELKLQGNQISV--LPALQ-LPRLLHLDLSYNSIP---PLVAQDLQ--TPHLESLKIAGLGLTSLD 208

  Fly   287 DNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSY 351
            :.....|..|.:||||:|.:..:.|. ...:|.||.|.|..|.:..:|...|..|:||..||||.
Zfish   209 EELLGSLVNLHVLDVSQNQLVDIQPT-LKSMGGLRNLNLTGNPLGSLKHEDFQNLVNLLELDLSN 272

  Fly   352 NNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRM----- 411
            .||:...|..|  |..|::.:|....|....|.|||:    |..:||         |||:     
Zfish   273 LNLQGFPEGFF--NLFPKLEKLTAAENPFNCLCPLAW----FPAWLK---------DVRVELLRT 322

  Fly   412 ------FAPM---RRLQKL 421
                  |.|:   :.|:||
Zfish   323 EETRCHFPPINSGKVLEKL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 44/152 (29%)
LRR_8 104..164 CDD:290566 15/59 (25%)
leucine-rich repeat 106..129 CDD:275380 8/22 (36%)
leucine-rich repeat 130..153 CDD:275380 6/22 (27%)
leucine-rich repeat 154..195 CDD:275380 4/40 (10%)
LRR_RI 194..455 CDD:238064 78/242 (32%)
LRR_8 194..254 CDD:290566 24/59 (41%)
leucine-rich repeat 196..219 CDD:275380 8/22 (36%)
leucine-rich repeat 220..243 CDD:275380 11/22 (50%)
leucine-rich repeat 244..267 CDD:275380 7/22 (32%)
LRR_8 271..330 CDD:290566 19/58 (33%)
leucine-rich repeat 272..295 CDD:275380 5/22 (23%)
leucine-rich repeat 296..319 CDD:275380 7/22 (32%)
LRR_8 319..380 CDD:290566 22/60 (37%)
leucine-rich repeat 320..343 CDD:275380 8/22 (36%)
leucine-rich repeat 344..369 CDD:275380 10/24 (42%)
LRR_8 368..428 CDD:290566 18/68 (26%)
leucine-rich repeat 370..393 CDD:275380 6/22 (27%)
leucine-rich repeat 394..417 CDD:275380 7/36 (19%)
leucine-rich repeat 418..441 CDD:275380 3/4 (75%)
vasnaNP_001313614.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.