DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and Lrrtm4

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_017448300.1 Gene:Lrrtm4 / 500219 RGDID:1560707 Length:591 Species:Rattus norvegicus


Alignment Length:462 Identity:109/462 - (23%)
Similarity:184/462 - (39%) Gaps:136/462 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LLDLDLTG---AAPINVHTNG---------FSILPNLRQLNLSGCGLVDIRGNHFAPESALQRID 134
            ||.:.|||   |.|.|...:|         |:.:|.    |:||               ..|.:.
  Rat    23 LLLVMLTGAQRACPKNCRCDGKIVYCESHAFADIPE----NISG---------------GSQGLS 68

  Fly   135 FSHNQMELLDRDFFGNLRKLIYANFSHNALKQCDLPHMPLLNRLELGHNRLVNATFGVCPQLQEL 199
            ...|.::.|..:.|..|.:||:                                          |
  Rat    69 LRFNSIQKLKSNQFAGLNQLIW------------------------------------------L 91

  Fly   200 ILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVF-G 263
            .|:.|.:..:|.:||:|:..|.||.||.|:::.:..:||.|:..||.|:||.|.|..|:...| |
  Rat    92 YLDHNYISSVDEDAFQGIRRLKELILSSNKITYLHNKTFHPVPNLRNLDLSYNKLQTLQSEQFKG 156

  Fly   264 AVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYN 328
            ..:..:|||:...|....||:     |:....|..||:..|.:.|||...|.||..|::|:|::|
  Rat   157 LRKLIILHLRSNSLKTVPIRV-----FQDCRNLDFLDLGYNRLRSLSRNAFAGLLKLKELHLEHN 216

  Fly   329 AILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPF 393
            ...:|..|.|..|.||.::.|.:|.:..:.:.:..  |...:..|:|:||.::.:.|..|..|| 
  Rat   217 QFSKINFAHFPRLFNLRSIYLQWNRIRSVSQGLTW--TWSSLHTLDLSGNDIQAIEPGTFKCLP- 278

  Fly   394 LEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKV 458
                                   .||||:|                        |:|:||.:::.
  Rat   279 -----------------------NLQKLNL------------------------DSNKLTNVSQE 296

  Fly   459 NV-SFPNLKRVAIEGNPWQ-----CPCFVKLQHWLATRDVVYLRDNTGYYKGERPLCIVTNVDYC 517
            .| ::.:|..:.:.||.|:     ||.|..|:::...::...:.....:.:||:....|...:.|
  Rat   297 TVNAWISLISITLSGNMWECSRSICPLFYWLKNFKGNKESTMICAGPKHIQGEKVSDAVETYNIC 361

  Fly   518 IQNLQAV 524
             .::|.|
  Rat   362 -SDVQVV 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 34/152 (22%)
LRR_8 104..164 CDD:290566 11/59 (19%)
leucine-rich repeat 106..129 CDD:275380 3/22 (14%)
leucine-rich repeat 130..153 CDD:275380 5/22 (23%)
leucine-rich repeat 154..195 CDD:275380 2/40 (5%)
LRR_RI 194..455 CDD:238064 73/261 (28%)
LRR_8 194..254 CDD:290566 22/59 (37%)
leucine-rich repeat 196..219 CDD:275380 7/22 (32%)
leucine-rich repeat 220..243 CDD:275380 9/22 (41%)
leucine-rich repeat 244..267 CDD:275380 10/23 (43%)
LRR_8 271..330 CDD:290566 20/58 (34%)
leucine-rich repeat 272..295 CDD:275380 5/22 (23%)
leucine-rich repeat 296..319 CDD:275380 10/22 (45%)
LRR_8 319..380 CDD:290566 17/60 (28%)
leucine-rich repeat 320..343 CDD:275380 8/22 (36%)
leucine-rich repeat 344..369 CDD:275380 4/24 (17%)
LRR_8 368..428 CDD:290566 13/59 (22%)
leucine-rich repeat 370..393 CDD:275380 7/22 (32%)
leucine-rich repeat 394..417 CDD:275380 0/22 (0%)
leucine-rich repeat 418..441 CDD:275380 5/22 (23%)
Lrrtm4XP_017448300.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.