Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001007769.1 | Gene: | farsb / 493608 | ZFINID: | ZDB-GENE-021206-2 | Length: | 590 | Species: | Danio rerio |
Alignment Length: | 269 | Identity: | 60/269 - (22%) |
---|---|---|---|
Similarity: | 104/269 - (38%) | Gaps: | 69/269 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 272 LQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIAS-----LSPAHFVGLGSLRKLYLQYNAIL 331
Fly 332 EIKPATFAALL-NLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLE 395
Fly 396 YLKLGHNELKSLDVRMFAPMRRLQKL-------------HLGHNLLEEINLDVLESLSSVQEILV 447
Fly 448 DNNRLTFLAKVNVSFPNLKRVAIEGNPWQCPCFVKLQHWLATRDVVYLRDNTGYYKGERPLCIVT 512
Fly 513 NV--DYCIQ 519 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | |
LRR_8 | 104..164 | CDD:290566 | |||
leucine-rich repeat | 106..129 | CDD:275380 | |||
leucine-rich repeat | 130..153 | CDD:275380 | |||
leucine-rich repeat | 154..195 | CDD:275380 | |||
LRR_RI | 194..455 | CDD:238064 | 45/201 (22%) | ||
LRR_8 | 194..254 | CDD:290566 | |||
leucine-rich repeat | 196..219 | CDD:275380 | |||
leucine-rich repeat | 220..243 | CDD:275380 | |||
leucine-rich repeat | 244..267 | CDD:275380 | |||
LRR_8 | 271..330 | CDD:290566 | 14/62 (23%) | ||
leucine-rich repeat | 272..295 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 296..319 | CDD:275380 | 6/27 (22%) | ||
LRR_8 | 319..380 | CDD:290566 | 15/61 (25%) | ||
leucine-rich repeat | 320..343 | CDD:275380 | 7/23 (30%) | ||
leucine-rich repeat | 344..369 | CDD:275380 | 3/24 (13%) | ||
LRR_8 | 368..428 | CDD:290566 | 17/72 (24%) | ||
leucine-rich repeat | 370..393 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 394..417 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 418..441 | CDD:275380 | 6/35 (17%) | ||
farsb | NP_001007769.1 | PLN02265 | 1..590 | CDD:215149 | 60/269 (22%) |
B3_4 | 120..281 | CDD:214876 | 43/199 (22%) | ||
B5 | 314..376 | CDD:281482 | |||
PheRS_beta_core | 396..589 | CDD:238392 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |