DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and AgaP_AGAP005668

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_001237694.1 Gene:AgaP_AGAP005668 / 4576765 VectorBaseID:AGAP005668 Length:405 Species:Anopheles gambiae


Alignment Length:385 Identity:92/385 - (23%)
Similarity:152/385 - (39%) Gaps:96/385 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 SILPNLRQLNLSGCGLVDIRGNHFAPESALQRIDFSHNQMELLDRDFFGNLRKLIYANFSHNALK 165
            |:...|:.|::.   |..:|...|...|.|:.:..::.|:..|. |...:...|::...:...::
Mosquito    91 SVPQTLKALSIE---LTRLRRIEFEANSTLKHLMIAYCQLSTLP-DAIQHAPMLLHLQITSCNIQ 151

  Fly   166 QCDLPHM---PLLNRLELGHNRL---VNATFGVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQ 224
            |.|:..:   .||:.:.|..|:|   .|.:...|      .|.|:               |..|.
Mosquito   152 QLDMASLCENALLSTVILTRNKLRYIANTSTKQC------ALYDS---------------LSALV 195

  Fly   225 LSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQ 289
            |:||||.||.:|.|....:|..:.|..|.:.:|....   |.|.:..| ::|:  ||:..:...|
Mosquito   196 LTGNRLKSINMELFNGFVRLDSVFLQSNRITSLAGRF---VHNAIAEL-RMDI--NRLAWVDLCQ 254

  Fly   290 FRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNL 354
            :.|.| |..|....|.:|.: |.....|.::.:|.|..|.:......:.|.:.:|.:|.||||.|
Mosquito   255 WSVPA-LVWLSFDENVLAEV-PKCMNNLKNITRLVLSSNVLSNFTIESVAGMEHLVSLSLSYNQL 317

  Fly   355 EFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQ 419
                            ..:.||..|....          ||::.|.||.|.|||: .|.|:|.|:
Mosquito   318 ----------------LSVTLNSERFPRR----------LEFINLYHNNLTSLDL-SFIPVRSLK 355

  Fly   420 KLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKVNV--SFPNLKRVAIEGNPWQC 477
                                       :|.:| .|:|..:|  :..|:.|:|:|.||..|
Mosquito   356 ---------------------------IDASR-NFIASFDVHGTSANVSRLAMEHNPIDC 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 36/158 (23%)
LRR_8 104..164 CDD:290566 11/59 (19%)
leucine-rich repeat 106..129 CDD:275380 5/22 (23%)
leucine-rich repeat 130..153 CDD:275380 4/22 (18%)
leucine-rich repeat 154..195 CDD:275380 10/46 (22%)
LRR_RI 194..455 CDD:238064 61/260 (23%)
LRR_8 194..254 CDD:290566 16/59 (27%)
leucine-rich repeat 196..219 CDD:275380 2/22 (9%)
leucine-rich repeat 220..243 CDD:275380 11/22 (50%)
leucine-rich repeat 244..267 CDD:275380 5/22 (23%)
LRR_8 271..330 CDD:290566 16/58 (28%)
leucine-rich repeat 272..295 CDD:275380 6/22 (27%)
leucine-rich repeat 296..319 CDD:275380 6/22 (27%)
LRR_8 319..380 CDD:290566 13/60 (22%)
leucine-rich repeat 320..343 CDD:275380 4/22 (18%)
leucine-rich repeat 344..369 CDD:275380 7/24 (29%)
LRR_8 368..428 CDD:290566 16/59 (27%)
leucine-rich repeat 370..393 CDD:275380 3/22 (14%)
leucine-rich repeat 394..417 CDD:275380 11/22 (50%)
leucine-rich repeat 418..441 CDD:275380 1/22 (5%)
AgaP_AGAP005668XP_001237694.1 leucine-rich repeat 117..139 CDD:275380 4/22 (18%)
leucine-rich repeat 164..190 CDD:275380 7/31 (23%)
LRR_8 190..247 CDD:290566 20/77 (26%)
leucine-rich repeat 191..214 CDD:275380 11/22 (50%)
leucine-rich repeat 215..259 CDD:275380 12/49 (24%)
leucine-rich repeat 260..282 CDD:275380 6/22 (27%)
LRR_8 281..341 CDD:290566 19/85 (22%)
leucine-rich repeat 283..306 CDD:275380 4/22 (18%)
leucine-rich repeat 307..330 CDD:275380 10/38 (26%)
leucine-rich repeat 354..365 CDD:275378 4/38 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.