DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6749 and znf534

DIOPT Version :9

Sequence 1:	NP_648354.1	Gene:	CG6749 / 39144	FlyBaseID:	FBgn0036040	Length:	552	Species:	Drosophila melanogaster
Sequence 2:	XP_012823677.1	Gene:	znf534 / 448416	XenbaseID:	XB-GENE-1219092	Length:	423	Species:	Xenopus tropicalis

Alignment Length:	133	Identity:	33/133 - (24%)
Similarity:	49/133 - (36%)	Gaps:	34/133 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly   409 VRMFAPMRRL---QKLHLGHNLLEEINLDVL-------ESLSSVQE-----------------IL 446
            :||.|....|   ::..:...||.::.|.:|       ||.|.|.|                 ||
Frog    39 IRMLASQPELSEHERAEMDKYLLSQVPLHILSDKKYRRESASVVDEFFEAEKPQAPYSVNINVIL 103

  Fly   447 VDNNRL-TFLAKVNVSFPNLKRVAIE-GNPWQCPCFVKLQHWLATRDVVY-----LRDNTGYYKG 504
            .|...| |.|.:.:.:|..|.:|..| |:.:..||...|...|.....|:     :..|..:.|.
Frog   104 PDTAHLRTGLYRPSKTFTVLPQVKTEPGSNFAQPCSASLTQTLPDFTSVFSMPHSVAVNNIFIKQ 168

  Fly   505 ERP 507
            |.|
Frog   169 EAP 171

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6749	NP_648354.1	LRR_RI	103..>256	CDD:238064
		LRR_8	104..164	CDD:290566
		leucine-rich repeat	106..129	CDD:275380
		leucine-rich repeat	130..153	CDD:275380
		leucine-rich repeat	154..195	CDD:275380
		LRR_RI	194..455	CDD:238064	18/73 (25%)
		LRR_8	194..254	CDD:290566
		leucine-rich repeat	196..219	CDD:275380
		leucine-rich repeat	220..243	CDD:275380
		leucine-rich repeat	244..267	CDD:275380
		LRR_8	271..330	CDD:290566
		leucine-rich repeat	272..295	CDD:275380
		leucine-rich repeat	296..319	CDD:275380
		LRR_8	319..380	CDD:290566
		leucine-rich repeat	320..343	CDD:275380
		leucine-rich repeat	344..369	CDD:275380
		LRR_8	368..428	CDD:290566	4/21 (19%)
		leucine-rich repeat	370..393	CDD:275380
		leucine-rich repeat	394..417	CDD:275380	3/7 (43%)
		leucine-rich repeat	418..441	CDD:275380	7/32 (22%)
znf534	XP_012823677.1	Meiotic_rec114	<169..287	CDD:367544	2/3 (67%)
		COG5048	<246..>423	CDD:227381
		C2H2 Zn finger	344..363	CDD:275368
		C2H2 Zn finger	371..393	CDD:275368
		zf-H2C2_2	385..410	CDD:372612
		C2H2 Zn finger	401..421	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910