DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and scrib

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster


Alignment Length:418 Identity:111/418 - (26%)
Similarity:166/418 - (39%) Gaps:139/418 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 HNQMELLDRDFFGNLRKLIYANFSHNALKQCDLPHMPLLNRLELGHNRLVNATFGVCPQLQELIL 201
            :.|:|.:|:                   :.|.||.:|   ...|.::|          .|:||.|
  Fly    12 NRQVEFVDK-------------------RHCSLPQVP---EEILRYSR----------TLEELFL 44

  Fly   202 NDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQ 266
            :.|.:..|..|.|| ||                        :||||.||.|.:..|.|:    :|
  Fly    45 DANHIRDLPKNFFR-LH------------------------RLRKLGLSDNEIGRLPPD----IQ 80

  Fly   267 NFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAIL 331
            ||. :|.:||:|.|.|..:.|: .:.|..||:.|.|.|.|..| |:.|..|.:|..|.|. :..|
  Fly    81 NFE-NLVELDVSRNDIPDIPDD-IKHLQSLQVADFSSNPIPKL-PSGFSQLKNLTVLGLN-DMSL 141

  Fly   332 EIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEY 396
            ...||.|.:|..|::|:|..|.|:.|.|.|   :.|.:::||:|..|.::.|.|. ...||.|..
  Fly   142 TTLPADFGSLTQLESLELRENLLKHLPETI---SQLTKLKRLDLGDNEIEDLPPY-LGYLPGLHE 202

  Fly   397 LKLGHNELKSLDVRM---------------------------------------------FAPMR 416
            |.|.||:|:.|...:                                             .|.:.
  Fly   203 LWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLS 267

  Fly   417 RLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKVNVSFP--------NLKRVAIEGN 473
            ||..|.|..|.|:.:| |.|.:..::||:::..|   ||:::..|..        |:.|.|:|..
  Fly   268 RLTILKLDQNRLQRLN-DTLGNCENMQELILTEN---FLSELPASIGQMTKLNNLNVDRNALEYL 328

  Fly   474 P---WQCPCFVKLQHWLATRDVVYLRDN 498
            |   .||          |...|:.||||
  Fly   329 PLEIGQC----------ANLGVLSLRDN 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 27/118 (23%)
LRR_8 104..164 CDD:290566 3/26 (12%)
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380 3/15 (20%)
leucine-rich repeat 154..195 CDD:275380 6/40 (15%)
LRR_RI 194..455 CDD:238064 86/305 (28%)
LRR_8 194..254 CDD:290566 18/59 (31%)
leucine-rich repeat 196..219 CDD:275380 10/22 (45%)
leucine-rich repeat 220..243 CDD:275380 0/22 (0%)
leucine-rich repeat 244..267 CDD:275380 9/22 (41%)
LRR_8 271..330 CDD:290566 21/58 (36%)
leucine-rich repeat 272..295 CDD:275380 8/22 (36%)
leucine-rich repeat 296..319 CDD:275380 10/22 (45%)
LRR_8 319..380 CDD:290566 21/60 (35%)
leucine-rich repeat 320..343 CDD:275380 8/22 (36%)
leucine-rich repeat 344..369 CDD:275380 9/24 (38%)
LRR_8 368..428 CDD:290566 21/104 (20%)
leucine-rich repeat 370..393 CDD:275380 7/22 (32%)
leucine-rich repeat 394..417 CDD:275380 8/67 (12%)
leucine-rich repeat 418..441 CDD:275380 8/22 (36%)
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 89/338 (26%)
leucine-rich repeat 18..38 CDD:275380 7/51 (14%)
LRR_8 37..95 CDD:290566 29/97 (30%)
leucine-rich repeat 39..61 CDD:275380 11/46 (24%)
leucine-rich repeat 62..84 CDD:275380 12/26 (46%)
LRR_8 84..138 CDD:290566 21/56 (38%)
leucine-rich repeat 85..107 CDD:275380 8/22 (36%)
leucine-rich repeat 108..130 CDD:275380 10/22 (45%)
LRR_8 129..187 CDD:290566 21/61 (34%)
leucine-rich repeat 131..153 CDD:275380 8/22 (36%)
leucine-rich repeat 154..176 CDD:275380 9/24 (38%)
leucine-rich repeat 177..199 CDD:275380 7/22 (32%)
LRR_8 198..256 CDD:290566 8/57 (14%)
leucine-rich repeat 200..222 CDD:275380 7/21 (33%)
leucine-rich repeat 223..245 CDD:275380 0/21 (0%)
LRR_8 267..325 CDD:290566 17/61 (28%)
leucine-rich repeat 269..289 CDD:275380 8/20 (40%)
leucine-rich repeat 292..314 CDD:275380 6/24 (25%)
leucine-rich repeat 315..337 CDD:275380 7/31 (23%)
LRR_4 337..375 CDD:289563 5/10 (50%)
leucine-rich repeat 361..382 CDD:275380
PDZ 728..816 CDD:214570
PDZ_signaling 931..1016 CDD:238492
PDZ 1239..1329 CDD:214570
PDZ_signaling 1336..1425 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.