| Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001019849.2 | Gene: | LRRC24 / 441381 | HGNCID: | 28947 | Length: | 513 | Species: | Homo sapiens |
| Alignment Length: | 310 | Identity: | 78/310 - (25%) |
|---|---|---|---|
| Similarity: | 102/310 - (32%) | Gaps: | 128/310 - (41%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 178 LELGHNRLVNATFGVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLA 242
Fly 243 QLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIA 307
Fly 308 SLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRR 372
Fly 373 LNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLE 437
Fly 438 SLSSVQEILVDNNRLTFLAKVNVSFPNLKRVAIEGNPWQCPCFVKLQHWL 487 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 22/77 (29%) |
| LRR_8 | 104..164 | CDD:290566 | |||
| leucine-rich repeat | 106..129 | CDD:275380 | |||
| leucine-rich repeat | 130..153 | CDD:275380 | |||
| leucine-rich repeat | 154..195 | CDD:275380 | 5/16 (31%) | ||
| LRR_RI | 194..455 | CDD:238064 | 65/260 (25%) | ||
| LRR_8 | 194..254 | CDD:290566 | 16/59 (27%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 220..243 | CDD:275380 | 2/22 (9%) | ||
| leucine-rich repeat | 244..267 | CDD:275380 | 10/22 (45%) | ||
| LRR_8 | 271..330 | CDD:290566 | 17/58 (29%) | ||
| leucine-rich repeat | 272..295 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 296..319 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 319..380 | CDD:290566 | 18/60 (30%) | ||
| leucine-rich repeat | 320..343 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 344..369 | CDD:275380 | 9/24 (38%) | ||
| LRR_8 | 368..428 | CDD:290566 | 6/59 (10%) | ||
| leucine-rich repeat | 370..393 | CDD:275380 | 3/22 (14%) | ||
| leucine-rich repeat | 394..417 | CDD:275380 | 1/22 (5%) | ||
| leucine-rich repeat | 418..441 | CDD:275380 | 6/22 (27%) | ||
| LRRC24 | NP_001019849.2 | LRR_RI | 49..>158 | CDD:238064 | 45/160 (28%) |
| LRR_8 | <50..86 | CDD:290566 | 16/59 (27%) | ||
| LRR 1 | 51..72 | 7/44 (16%) | |||
| leucine-rich repeat | 53..75 | CDD:275380 | 9/45 (20%) | ||
| LRR 2 | 75..96 | 9/20 (45%) | |||
| LRR_8 | 76..134 | CDD:290566 | 27/85 (32%) | ||
| leucine-rich repeat | 76..99 | CDD:275380 | 10/26 (38%) | ||
| LRR 3 | 99..120 | 8/44 (18%) | |||
| leucine-rich repeat | 100..123 | CDD:275380 | 11/46 (24%) | ||
| LRR_8 | 123..205 | CDD:290566 | 33/154 (21%) | ||
| LRR 4 | 123..144 | 8/20 (40%) | |||
| leucine-rich repeat | 124..147 | CDD:275380 | 9/22 (41%) | ||
| LRR 5 | 147..168 | 8/20 (40%) | |||
| leucine-rich repeat | 148..171 | CDD:275380 | 9/45 (20%) | ||
| LRR 6 | 171..192 | 8/47 (17%) | |||
| leucine-rich repeat | 172..195 | CDD:275380 | 8/49 (16%) | ||
| LRRCT | 204..257 | CDD:214507 | 8/15 (53%) | ||
| Ig | 259..364 | CDD:299845 | |||
| IG_like | 266..362 | CDD:214653 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 365..391 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||