DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and alrm

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_651393.1 Gene:alrm / 43074 FlyBaseID:FBgn0039332 Length:471 Species:Drosophila melanogaster


Alignment Length:392 Identity:107/392 - (27%)
Similarity:167/392 - (42%) Gaps:81/392 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 FSILPNLRQLNLSGCGLVDIRGNHFAPESALQRIDFSHNQMELLDRDFFGNLRKLIYANFSHNAL 164
            |...|:|:.|.:..|.|.......|...|.|..:...:|:::.:.::.|.....|...:...|.|
  Fly    85 FDTFPDLQVLRMENCSLETFEKPQFEGASNLMSLFLGYNRLKDIPKNIFLGADNLATLHLQGNQL 149

  Fly   165 KQCDLPHMPLLNRLELGHNRLVNATFGVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNR 229
            ||                  |.|.:|....:::||.|.:|||.|:.:..|.|:..|::|.|:|||
  Fly   150 KQ------------------LGNHSFHALKEVKELSLAENQLEQISLGVFSGMRKLMDLNLAGNR 196

  Fly   230 LSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQ----QLDLSGNRIRLLFDNQF 290
            |.::....|.....|.||||::|.        |.|.::.:|.||    |||:|||..:.|..|  
  Fly   197 LDALPRGVFDRNLNLTKLNLARNR--------FTAFESELLKLQPVFTQLDISGNIFQELTLN-- 251

  Fly   291 RVLARLQMLDVSRNSIASLSPAHFVGL------GSLRKLYLQYNAILEIKPATFAALLNLDTLDL 349
                 ..||||        :.||...|      |.:.:|.|..|::.|:.....||  |:.:|||
  Fly   252 -----FTMLDV--------AIAHSCDLRRLTVYGVIHELDLHNNSLREMPHIPLAA--NVSSLDL 301

  Fly   350 SYNNLEFLEEQIFGGNTLPR---MRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRM 411
            |:|.|..|:     ||.|.|   :.||||:......|....|.....|:.|.:..|.:.||.:.:
  Fly   302 SHNPLGNLQ-----GNPLRRFTSLLRLNLSATGAHELPEGLFKKQSHLQMLDISGNSIYSLKITI 361

  Fly   412 FAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKVNVSF------PNLKRVAI 470
            |..::.||..:...|   ..|.|.|:.|.|           :|:.:.::||      |.|....:
  Fly   362 FDSLKALQYFYFQQN---NWNCDFLQLLMS-----------SFVKRKDISFMEDITAPELVDDYV 412

  Fly   471 EG 472
            :|
  Fly   413 DG 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 41/152 (27%)
LRR_8 104..164 CDD:290566 12/59 (20%)
leucine-rich repeat 106..129 CDD:275380 5/22 (23%)
leucine-rich repeat 130..153 CDD:275380 3/22 (14%)
leucine-rich repeat 154..195 CDD:275380 8/40 (20%)
LRR_RI 194..455 CDD:238064 82/273 (30%)
LRR_8 194..254 CDD:290566 23/59 (39%)
leucine-rich repeat 196..219 CDD:275380 9/22 (41%)
leucine-rich repeat 220..243 CDD:275380 8/22 (36%)
leucine-rich repeat 244..267 CDD:275380 8/22 (36%)
LRR_8 271..330 CDD:290566 21/68 (31%)
leucine-rich repeat 272..295 CDD:275380 10/26 (38%)
leucine-rich repeat 296..319 CDD:275380 7/28 (25%)
LRR_8 319..380 CDD:290566 22/63 (35%)
leucine-rich repeat 320..343 CDD:275380 6/22 (27%)
leucine-rich repeat 344..369 CDD:275380 10/24 (42%)
LRR_8 368..428 CDD:290566 16/62 (26%)
leucine-rich repeat 370..393 CDD:275380 6/22 (27%)
leucine-rich repeat 394..417 CDD:275380 6/22 (27%)
leucine-rich repeat 418..441 CDD:275380 7/22 (32%)
alrmNP_651393.1 LRR_RI 84..354 CDD:238064 90/316 (28%)
LRR_8 91..149 CDD:290566 11/57 (19%)
leucine-rich repeat 91..114 CDD:275380 5/22 (23%)
leucine-rich repeat 115..138 CDD:275380 3/22 (14%)
LRR_8 138..197 CDD:290566 22/76 (29%)
leucine-rich repeat 139..162 CDD:275380 8/40 (20%)
leucine-rich repeat 163..186 CDD:275380 9/22 (41%)
LRR_8 185..243 CDD:290566 23/65 (35%)
leucine-rich repeat 187..210 CDD:275380 8/22 (36%)
leucine-rich repeat 211..283 CDD:275380 29/94 (31%)
leucine-rich repeat 284..319 CDD:275380 15/41 (37%)
LRR_8 318..377 CDD:290566 15/61 (25%)
leucine-rich repeat 320..343 CDD:275380 6/22 (27%)
leucine-rich repeat 344..365 CDD:275380 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.