DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and CG5810

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_650952.2 Gene:CG5810 / 42513 FlyBaseID:FBgn0038866 Length:428 Species:Drosophila melanogaster


Alignment Length:409 Identity:101/409 - (24%)
Similarity:162/409 - (39%) Gaps:96/409 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 ANFSHNALKQCDLPHMPLLNRLELGHNRLVN---ATFGVCPQLQELILNDNQLIQLDVNAFRGLH 218
            |.||.|..|     |:.....|.|..:.|.|   ..|...|||.|..:.:.:|.|::...|.|..
  Fly    52 AYFSENVTK-----HLRKYETLVLHSSDLANLPRKIFLNLPQLVEFHVLECELQQIESVCFDGAK 111

  Fly   219 GLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIR 283
            .|..|...||.|..:...||:...||.:||||.|.|:.|...:|..::|    ||:::||.||:.
  Fly   112 NLKRLNFGGNALRVLDSNTFELATQLEELNLSDNQLEDLPTTIFRPLKN----LQKINLSNNRLI 172

  Fly   284 LLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGS-LRKLYLQYNAILEIKPATFAALLNLDTL 347
            .|..:.|..|..|:.::|..|.:..|....|..... |.:...|.|.::.|   .|.....:|.|
  Fly   173 TLSQHIFSQLGSLKSINVDSNQLVELPGELFRDQRKHLSEFSAQSNQLVRI---PFNIFREIDHL 234

  Fly   348 DLSYNNLEFLEEQIFGGNTLPRMRRLNLNG--NRMK------------------------HLHPL 386
            .||:|               |::|||:|:.  |.::                        .||.|
  Fly   235 SLSFN---------------PQLRRLHLSAKINELEATNCDLESVELDGRVIGVQLEANPKLHEL 284

  Fly   387 AFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNR 451
            ..|....||:|.|.:..|..||.     :.:..||         ::|||.:.::     |.|..:
  Fly   285 KISQPQDLEHLYLANTNLYRLDF-----LSKASKL---------VDLDVTDIVN-----LADLPK 330

  Fly   452 LTF---LAKVNVSFPNLKRVAIEGNPWQCPCFVKLQHWLATRDVVYLRDNTGYYKGERPLCIVTN 513
            :|.   |.:::.::.||....::          .|.|   .:|:.||  ...:.||:.......:
  Fly   331 ITSAKGLERLSFTYDNLTSNHMD----------MLPH---LKDLNYL--EISHEKGKEIFIKDLD 380

  Fly   514 VDYCIQNLQAVRRLGILGD 532
            .|:.::  :|....|.|.|
  Fly   381 EDFFVE--EAELNCGQLAD 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 34/101 (34%)
LRR_8 104..164 CDD:290566 4/6 (67%)
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380 11/40 (28%)
LRR_RI 194..455 CDD:238064 75/290 (26%)
LRR_8 194..254 CDD:290566 22/59 (37%)
leucine-rich repeat 196..219 CDD:275380 6/22 (27%)
leucine-rich repeat 220..243 CDD:275380 7/22 (32%)
leucine-rich repeat 244..267 CDD:275380 9/22 (41%)
LRR_8 271..330 CDD:290566 17/59 (29%)
leucine-rich repeat 272..295 CDD:275380 9/22 (41%)
leucine-rich repeat 296..319 CDD:275380 5/22 (23%)
LRR_8 319..380 CDD:290566 16/63 (25%)
leucine-rich repeat 320..343 CDD:275380 5/22 (23%)
leucine-rich repeat 344..369 CDD:275380 5/24 (21%)
LRR_8 368..428 CDD:290566 19/85 (22%)
leucine-rich repeat 370..393 CDD:275380 9/48 (19%)
leucine-rich repeat 394..417 CDD:275380 7/22 (32%)
leucine-rich repeat 418..441 CDD:275380 5/22 (23%)
CG5810NP_650952.2 leucine-rich repeat 65..88 CDD:275380 5/22 (23%)
LRR_8 87..147 CDD:290566 22/59 (37%)
leucine-rich repeat 89..112 CDD:275380 6/22 (27%)
leucine-rich repeat 113..136 CDD:275380 7/22 (32%)
LRR_8 135..195 CDD:290566 23/63 (37%)
LRR_4 135..175 CDD:289563 17/43 (40%)
leucine-rich repeat 137..160 CDD:275380 9/22 (41%)
leucine-rich repeat 161..184 CDD:275380 9/22 (41%)
leucine-rich repeat 185..209 CDD:275380 5/23 (22%)
leucine-rich repeat 210..231 CDD:275380 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453502
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.