DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and sds22

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster


Alignment Length:292 Identity:79/292 - (27%)
Similarity:133/292 - (45%) Gaps:38/292 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 LELGHNRLVN-ATFGVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPL 241
            |:|.|.|:.. ..|....:::.|.|..|.:.:::  ....|..|:||:|..|:::.|  |....|
  Fly    44 LDLNHRRIEKLENFEPLTRIERLFLRWNLIKKIE--NLSSLKTLIELELYDNQITKI--ENLDDL 104

  Fly   242 AQLRKLNLSQNALDALR--------PNVFGAVQNFVLHLQQLDLSGNRIRL-LFDNQFR------ 291
            ..|..|::|.|.|..:.        ..|: .|.|.:..::.||:..|...| |.||:.:      
  Fly   105 PHLEVLDISFNRLTKIENLDKLVKLEKVY-FVSNRITQIENLDMLTNLTMLELGDNKLKKIENIE 168

  Fly   292 VLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEF 356
            :|..|:.|.:.:|.||.:.  :...|.:|..|.||.|.|::|:  ....|.||..|.:|.|.:|.
  Fly   169 MLVNLRQLFLGKNKIAKIE--NLDTLVNLEILSLQANRIVKIE--NLEKLANLRELYVSENGVET 229

  Fly   357 LEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKS-LDVRMFAPMRRLQK 420
            :|.  ...||  ::..|:|..||:|.:..|  ..|..||.|.|.||.:.. .|:.:....:.||.
  Fly   230 IEN--LSENT--KLETLDLAKNRLKGIANL--EKLELLEELWLNHNGVDDWKDIELLKVNKALQT 288

  Fly   421 LHLGHN-LLEEINL-----DVLESLSSVQEIL 446
            ::|.:| |.:::..     |:|..|..:...|
  Fly   289 IYLEYNPLAKDVRYRSKLRDILPQLQKIDATL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 22/78 (28%)
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380 5/17 (29%)
LRR_RI 194..455 CDD:238064 74/275 (27%)
LRR_8 194..254 CDD:290566 16/59 (27%)
leucine-rich repeat 196..219 CDD:275380 4/22 (18%)
leucine-rich repeat 220..243 CDD:275380 8/22 (36%)
leucine-rich repeat 244..267 CDD:275380 7/30 (23%)
LRR_8 271..330 CDD:290566 19/65 (29%)
leucine-rich repeat 272..295 CDD:275380 8/29 (28%)
leucine-rich repeat 296..319 CDD:275380 6/22 (27%)
LRR_8 319..380 CDD:290566 20/60 (33%)
leucine-rich repeat 320..343 CDD:275380 8/22 (36%)
leucine-rich repeat 344..369 CDD:275380 8/24 (33%)
LRR_8 368..428 CDD:290566 18/61 (30%)
leucine-rich repeat 370..393 CDD:275380 7/22 (32%)
leucine-rich repeat 394..417 CDD:275380 7/23 (30%)
leucine-rich repeat 418..441 CDD:275380 8/28 (29%)
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380 5/17 (29%)
LRR_8 61..117 CDD:290566 16/59 (27%)
leucine-rich repeat 63..84 CDD:275380 4/22 (18%)
LRR_4 83..125 CDD:289563 13/43 (30%)
leucine-rich repeat 85..106 CDD:275380 8/22 (36%)
LRR_8 105..183 CDD:290566 19/78 (24%)
leucine-rich repeat 107..128 CDD:275380 5/20 (25%)
LRR_4 128..168 CDD:289563 10/40 (25%)
leucine-rich repeat 129..150 CDD:275380 5/21 (24%)
LRR_4 149..189 CDD:289563 11/41 (27%)
leucine-rich repeat 151..172 CDD:275380 5/20 (25%)
leucine-rich repeat 173..194 CDD:275380 6/22 (27%)
LRR_8 194..249 CDD:290566 20/60 (33%)
LRR_4 194..235 CDD:289563 15/44 (34%)
leucine-rich repeat 195..216 CDD:275380 8/22 (36%)
leucine-rich repeat 217..238 CDD:275380 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.