| Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_002336.1 | Gene: | LUM / 4060 | HGNCID: | 6724 | Length: | 338 | Species: | Homo sapiens |
| Alignment Length: | 348 | Identity: | 86/348 - (24%) |
|---|---|---|---|
| Similarity: | 138/348 - (39%) | Gaps: | 91/348 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 155 IYANFSHNALKQCDLPH----MPLLNRLELGHNRLVNATFGVCPQLQELILNDNQLIQLDVNAFR 215
Fly 216 GLHGLLELQLSGNRL--SSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLS 278
Fly 279 GNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILE-IKPATFAALL 342
Fly 343 NLDTLDLSYNNLEFLEEQIFGGNTLP-RMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKS 406
Fly 407 LDVRMFAP-----MRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKVN------- 459
Fly 460 ---------VSFPNLKRVAIEGN 473 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 31/106 (29%) |
| LRR_8 | 104..164 | CDD:290566 | 4/8 (50%) | ||
| leucine-rich repeat | 106..129 | CDD:275380 | |||
| leucine-rich repeat | 130..153 | CDD:275380 | |||
| leucine-rich repeat | 154..195 | CDD:275380 | 9/43 (21%) | ||
| LRR_RI | 194..455 | CDD:238064 | 71/269 (26%) | ||
| LRR_8 | 194..254 | CDD:290566 | 22/61 (36%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 220..243 | CDD:275380 | 9/24 (38%) | ||
| leucine-rich repeat | 244..267 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 271..330 | CDD:290566 | 13/58 (22%) | ||
| leucine-rich repeat | 272..295 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 296..319 | CDD:275380 | 3/22 (14%) | ||
| LRR_8 | 319..380 | CDD:290566 | 20/62 (32%) | ||
| leucine-rich repeat | 320..343 | CDD:275380 | 8/23 (35%) | ||
| leucine-rich repeat | 344..369 | CDD:275380 | 9/25 (36%) | ||
| LRR_8 | 368..428 | CDD:290566 | 18/65 (28%) | ||
| leucine-rich repeat | 370..393 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 394..417 | CDD:275380 | 9/27 (33%) | ||
| leucine-rich repeat | 418..441 | CDD:275380 | 6/22 (27%) | ||
| LUM | NP_002336.1 | LRRNT | 37..71 | CDD:214470 | 6/39 (15%) |
| LRR 1 | 67..88 | 7/20 (35%) | |||
| inl_like_NEAT_1 | <68..>310 | CDD:411101 | 74/297 (25%) | ||
| leucine-rich repeat | 68..91 | CDD:275380 | 7/22 (32%) | ||
| LRR 2 | 91..114 | 8/22 (36%) | |||
| leucine-rich repeat | 92..117 | CDD:275380 | 9/24 (38%) | ||
| LRR 3 | 117..137 | 7/26 (27%) | |||
| leucine-rich repeat | 118..138 | CDD:275380 | 6/26 (23%) | ||
| LRR 4 | 138..159 | 8/46 (17%) | |||
| leucine-rich repeat | 139..160 | CDD:275380 | 9/46 (20%) | ||
| LRR 5 | 160..181 | 6/20 (30%) | |||
| leucine-rich repeat | 161..185 | CDD:275380 | 8/23 (35%) | ||
| LRR 6 | 185..205 | 8/25 (32%) | |||
| leucine-rich repeat | 186..206 | CDD:275380 | 9/25 (36%) | ||
| LRR 7 | 206..227 | 4/20 (20%) | |||
| leucine-rich repeat | 207..230 | CDD:275380 | 4/22 (18%) | ||
| LRR 8 | 230..253 | 9/26 (35%) | |||
| leucine-rich repeat | 231..255 | CDD:275380 | 9/27 (33%) | ||
| LRR 9 | 255..276 | 7/33 (21%) | |||
| leucine-rich repeat | 276..305 | CDD:275380 | 3/28 (11%) | ||
| LRR 10 | 277..296 | 2/18 (11%) | |||
| LRR 11 | 305..326 | 3/10 (30%) | |||
| leucine-rich repeat | 306..329 | CDD:275380 | 3/9 (33%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||