DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and rtn4r

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_982345.1 Gene:rtn4r / 403306 ZFINID:ZDB-GENE-040310-1 Length:479 Species:Danio rerio


Alignment Length:230 Identity:66/230 - (28%)
Similarity:99/230 - (43%) Gaps:29/230 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 QELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNV 261
            |.:.|..|:|..:...:|..:|.|..|.:..|.:|.|....|..|.:|.:|::..|         
Zfish    60 QRIFLQSNKLTVVRSTSFSSVHNLTVLWMYSNNISHIEAGAFYGLERLEELDIGDN--------- 115

  Fly   262 FGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQ 326
                              :.:|::....||.|.:|..|.:.|..::.|....|.||.||:.||||
Zfish   116 ------------------SNLRIISPTAFRGLTKLHTLHLHRCGLSELPVGVFRGLFSLQYLYLQ 162

  Fly   327 YNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSL 391
            .|.:|.:...||..|.||..|.|..|.::.:.:.:..|  |..:.||.|:.||:.|:...||:.|
Zfish   163 DNNLLALHEDTFLDLANLTYLFLHNNKIKVVTDHMLRG--LVNLDRLLLHQNRIVHVQQQAFNDL 225

  Fly   392 PFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHN 426
            ..|..|.|..|.|..|......|:..||.|.|..|
Zfish   226 SKLTTLFLFFNNLTMLTGESMNPLVSLQYLRLNGN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 16/58 (28%)
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380
LRR_RI 194..455 CDD:238064 66/230 (29%)
LRR_8 194..254 CDD:290566 16/56 (29%)
leucine-rich repeat 196..219 CDD:275380 5/21 (24%)
leucine-rich repeat 220..243 CDD:275380 7/22 (32%)
leucine-rich repeat 244..267 CDD:275380 3/22 (14%)
LRR_8 271..330 CDD:290566 18/58 (31%)
leucine-rich repeat 272..295 CDD:275380 4/22 (18%)
leucine-rich repeat 296..319 CDD:275380 7/22 (32%)
LRR_8 319..380 CDD:290566 22/60 (37%)
leucine-rich repeat 320..343 CDD:275380 10/22 (45%)
leucine-rich repeat 344..369 CDD:275380 6/24 (25%)
LRR_8 368..428 CDD:290566 21/59 (36%)
leucine-rich repeat 370..393 CDD:275380 9/22 (41%)
leucine-rich repeat 394..417 CDD:275380 7/22 (32%)
leucine-rich repeat 418..441 CDD:275380 5/9 (56%)
rtn4rNP_982345.1 leucine-rich repeat 40..57 CDD:275380
LRR_8 60..115 CDD:290566 15/54 (28%)
leucine-rich repeat 60..82 CDD:275380 5/21 (24%)
leucine-rich repeat 83..106 CDD:275380 7/22 (32%)
leucine-rich repeat 107..131 CDD:275380 7/50 (14%)
leucine-rich repeat 132..155 CDD:275380 7/22 (32%)
LRR_8 155..214 CDD:290566 22/60 (37%)
leucine-rich repeat 156..179 CDD:275380 10/22 (45%)
leucine-rich repeat 180..203 CDD:275380 6/24 (25%)
LRR_8 203..261 CDD:290566 21/58 (36%)
leucine-rich repeat 204..227 CDD:275380 9/22 (41%)
leucine-rich repeat 228..251 CDD:275380 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.