| Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_982345.1 | Gene: | rtn4r / 403306 | ZFINID: | ZDB-GENE-040310-1 | Length: | 479 | Species: | Danio rerio |
| Alignment Length: | 230 | Identity: | 66/230 - (28%) |
|---|---|---|---|
| Similarity: | 99/230 - (43%) | Gaps: | 29/230 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 197 QELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNV 261
Fly 262 FGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQ 326
Fly 327 YNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSL 391
Fly 392 PFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHN 426 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 16/58 (28%) |
| LRR_8 | 104..164 | CDD:290566 | |||
| leucine-rich repeat | 106..129 | CDD:275380 | |||
| leucine-rich repeat | 130..153 | CDD:275380 | |||
| leucine-rich repeat | 154..195 | CDD:275380 | |||
| LRR_RI | 194..455 | CDD:238064 | 66/230 (29%) | ||
| LRR_8 | 194..254 | CDD:290566 | 16/56 (29%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 5/21 (24%) | ||
| leucine-rich repeat | 220..243 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 244..267 | CDD:275380 | 3/22 (14%) | ||
| LRR_8 | 271..330 | CDD:290566 | 18/58 (31%) | ||
| leucine-rich repeat | 272..295 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 296..319 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 319..380 | CDD:290566 | 22/60 (37%) | ||
| leucine-rich repeat | 320..343 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 344..369 | CDD:275380 | 6/24 (25%) | ||
| LRR_8 | 368..428 | CDD:290566 | 21/59 (36%) | ||
| leucine-rich repeat | 370..393 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 394..417 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 418..441 | CDD:275380 | 5/9 (56%) | ||
| rtn4r | NP_982345.1 | leucine-rich repeat | 40..57 | CDD:275380 | |
| LRR_8 | 60..115 | CDD:290566 | 15/54 (28%) | ||
| leucine-rich repeat | 60..82 | CDD:275380 | 5/21 (24%) | ||
| leucine-rich repeat | 83..106 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 107..131 | CDD:275380 | 7/50 (14%) | ||
| leucine-rich repeat | 132..155 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 155..214 | CDD:290566 | 22/60 (37%) | ||
| leucine-rich repeat | 156..179 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 180..203 | CDD:275380 | 6/24 (25%) | ||
| LRR_8 | 203..261 | CDD:290566 | 21/58 (36%) | ||
| leucine-rich repeat | 204..227 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 228..251 | CDD:275380 | 7/22 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||