DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and Toll-6

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001246765.1 Gene:Toll-6 / 39663 FlyBaseID:FBgn0036494 Length:1514 Species:Drosophila melanogaster


Alignment Length:565 Identity:148/565 - (26%)
Similarity:231/565 - (40%) Gaps:120/565 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GFPILHGA-DLCQPIGWRNFQCSEVASLQDLVDLGAE----NW------HTLAIRNV-QTELEVG 71
            |.|.|:.| |.|..:........|:|...:|..:.:|    |:      ||:|:..: ..|:...
  Fly    70 GDPSLYDAPDDCHFMPAAGLDQPEIALTCNLRTVNSEFDTTNFSVIPAEHTIALHILCNDEIMAK 134

  Fly    72 SGENADHLANLLDLDLTGAAPINVHTNGFSILPNLRQL--------NLSGCGL-VDIRGNHFAPE 127
            |...|...|:|:.|.........:...|..:|..|.||        |:....| .:|..:.|:..
  Fly   135 SRLEAQSFAHLVRLQQLSIQYCKLGRLGRQVLDGLEQLRNLTLRTHNILWPALNFEIEADAFSVT 199

  Fly   128 SALQRIDFSHNQMELLDRDFFGNLRKLIYANFSHNALK--------------------------- 165
            ..|:|:|.|.|.:..|..:.|..|.:|...|.|.|.|:                           
  Fly   200 RRLERLDLSSNNIWSLPDNIFCTLSELSALNMSENRLQDVNELGFRDRSKEPTNGSTESTSTTES 264

  Fly   166 ---------QCDLPHMPLLNRLELGHNRLV----NATFGVCPQLQELILNDNQLIQLDVNAFRGL 217
                     .|.|.    |..|::.||..|    |. ||...:|:.|.:|:|.:..:...|..||
  Fly   265 AKKSSSSSTSCSLD----LEYLDVSHNDFVVLPANG-FGTLRRLRVLSVNNNGISMIADKALSGL 324

  Fly   218 HGLLELQLSGNRLSSIGLETFQPLAQ-LRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNR 281
            ..|..|.||.|::.::..|.|...|: ::::.|..|::..|.|.:|..:.    .||.||||.|:
  Fly   325 KNLQILNLSSNKIVALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSNLD----QLQALDLSMNQ 385

  Fly   282 IRLLF--DNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNL 344
            |...:  .|.|..|.||.:|::|.|.:..|.|..|..|.:|:.|.|::|.:..|...|||.:.||
  Fly   386 ITSTWIDKNTFVGLIRLVLLNLSHNKLTKLEPEIFSDLYTLQILNLRHNQLENIAADTFAPMNNL 450

  Fly   345 DTLDLSYNNLEFLEEQIFGG-----------NTL-----------PRMRRLNLNGNRMKHLHPLA 387
            .||.||:|.|::|:.....|           |.|           ..::.||||||::|.: |||
  Fly   451 HTLLLSHNKLKYLDAYALNGLYVLSLLSLDNNALIGVHPDAFRNCSALQDLNLNGNQLKTV-PLA 514

  Fly   388 FSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEI---------NLDVL------- 436
            ..::..|..:.||.|.:..::...|..:..|..|.|..|.||.|         ||.:|       
  Fly   515 LRNMRHLRTVDLGENMITVMEDSAFKGLGNLYGLRLIGNYLENITMHTFRDLPNLQILNLARNRI 579

  Fly   437 --------ESLSSVQEILVDNNRLTFLAKVNVSFPNLKRVAIEGN 473
                    |..||:|.:.:|.|.|..:..:..:.|:|..:.|..|
  Fly   580 AVVEPGAFEMTSSIQAVRLDGNELNDINGLFSNMPSLLWLNISDN 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 48/202 (24%)
LRR_8 104..164 CDD:290566 19/68 (28%)
leucine-rich repeat 106..129 CDD:275380 7/31 (23%)
leucine-rich repeat 130..153 CDD:275380 8/22 (36%)
leucine-rich repeat 154..195 CDD:275380 15/80 (19%)
LRR_RI 194..455 CDD:238064 92/309 (30%)
LRR_8 194..254 CDD:290566 17/60 (28%)
leucine-rich repeat 196..219 CDD:275380 7/22 (32%)
leucine-rich repeat 220..243 CDD:275380 7/22 (32%)
leucine-rich repeat 244..267 CDD:275380 5/22 (23%)
LRR_8 271..330 CDD:290566 24/60 (40%)
leucine-rich repeat 272..295 CDD:275380 11/24 (46%)
leucine-rich repeat 296..319 CDD:275380 8/22 (36%)
LRR_8 319..380 CDD:290566 26/82 (32%)
leucine-rich repeat 320..343 CDD:275380 8/22 (36%)
leucine-rich repeat 344..369 CDD:275380 11/46 (24%)
LRR_8 368..428 CDD:290566 19/59 (32%)
leucine-rich repeat 370..393 CDD:275380 10/22 (45%)
leucine-rich repeat 394..417 CDD:275380 5/22 (23%)
leucine-rich repeat 418..441 CDD:275380 11/46 (24%)
Toll-6NP_001246765.1 leucine-rich repeat 148..171 CDD:275380 4/22 (18%)
LRR_8 171..236 CDD:290566 18/64 (28%)
leucine-rich repeat 172..201 CDD:275380 5/28 (18%)
leucine-rich repeat 202..278 CDD:275380 14/75 (19%)
leucine-rich repeat 229..249 CDD:275380 4/19 (21%)
LRR_RI 278..468 CDD:238064 65/198 (33%)
leucine-rich repeat 279..302 CDD:275380 8/23 (35%)
LRR_8 301..386 CDD:290566 27/88 (31%)
leucine-rich repeat 303..326 CDD:275380 7/22 (32%)
leucine-rich repeat 327..350 CDD:275380 7/22 (32%)
LRR 350..729 CDD:227223 81/280 (29%)
leucine-rich repeat 352..375 CDD:275380 5/26 (19%)
leucine-rich repeat 376..401 CDD:275380 11/24 (46%)
LRR_RI <401..626 CDD:238064 65/225 (29%)
leucine-rich repeat 402..425 CDD:275380 8/22 (36%)
leucine-rich repeat 426..449 CDD:275380 8/22 (36%)
leucine-rich repeat 450..473 CDD:275380 9/22 (41%)
leucine-rich repeat 474..497 CDD:275380 2/22 (9%)
leucine-rich repeat 498..518 CDD:275380 10/20 (50%)
leucine-rich repeat 521..544 CDD:275380 5/22 (23%)
leucine-rich repeat 545..566 CDD:275380 7/20 (35%)
leucine-rich repeat 569..592 CDD:275380 3/22 (14%)
leucine-rich repeat 593..615 CDD:275380 4/21 (19%)
leucine-rich repeat 616..637 CDD:275380 3/9 (33%)
leucine-rich repeat 638..662 CDD:275380
leucine-rich repeat 663..684 CDD:275380
leucine-rich repeat 685..708 CDD:275380
leucine-rich repeat 709..728 CDD:275380
LRR_8 883..943 CDD:290566
leucine-rich repeat 885..908 CDD:275380
leucine-rich repeat 909..932 CDD:275380
LRR_8 932..990 CDD:290566
leucine-rich repeat 933..956 CDD:275380
TIR 1114..1247 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453601
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.