DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and Con

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001246635.1 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster


Alignment Length:363 Identity:98/363 - (26%)
Similarity:153/363 - (42%) Gaps:95/363 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LRKLIYANFSHNALKQCD-LPHM---PLLNR----LELGHNRLVNA-TFGVCPQLQELILNDNQL 206
            ||:|.:. ..:||  :.| :|.|   ||.|.    :|.....:|.: .|...|.|:.:|||:|.:
  Fly   158 LRELKFV-IQNNA--RLDYIPTMIIEPLKNLSSIVIEYSQVEIVKSYAFANLPFLERIILNNNHI 219

  Fly   207 IQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLH 271
            :.||.:||            .|.:            :||:|||..|.:..:....|   :|..| 
  Fly   220 MALDQDAF------------ANHI------------RLRELNLEHNQIFEMDRYAF---RNLPL- 256

  Fly   272 LQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPA 336
            .::|.|:.|.|..|.:..|..:|||..|:::.|.|..|:...|.|||:|..|.|..|.:..|...
  Fly   257 CERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTRNNLNFIGDT 321

  Fly   337 TFAALLNLDTLDLSYNNLEFLEEQIFGG-NTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLG 400
            .||.|.:|..|:|..|.:|.:.|:...| |||   :.|||..|.:|.:........|.|..:.:.
  Fly   322 VFAELWSLSELELDDNRIERISERALDGLNTL---KTLNLRNNLLKKIDNGLLRGTPALLSINVQ 383

  Fly   401 HNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKVNVSFPNL 465
            .|:|::|....|.|:                 :|.|  ::|..|:||.:|:..            
  Fly   384 ANKLETLTFYTFQPI-----------------MDNL--VNSTSELLVSDNKFI------------ 417

  Fly   466 KRVAIEGNPWQCPCFVKLQHWL-----ATRDVVYLRDN 498
                       |.|  :|| |:     .||. :.|||:
  Fly   418 -----------CDC--RLQ-WIFELKNRTRH-LQLRDS 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 31/113 (27%)
LRR_8 104..164 CDD:290566 4/12 (33%)
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380 1/1 (100%)
leucine-rich repeat 154..195 CDD:275380 12/49 (24%)
LRR_RI 194..455 CDD:238064 74/261 (28%)
LRR_8 194..254 CDD:290566 17/59 (29%)
leucine-rich repeat 196..219 CDD:275380 9/22 (41%)
leucine-rich repeat 220..243 CDD:275380 1/22 (5%)
leucine-rich repeat 244..267 CDD:275380 7/22 (32%)
LRR_8 271..330 CDD:290566 21/58 (36%)
leucine-rich repeat 272..295 CDD:275380 6/22 (27%)
leucine-rich repeat 296..319 CDD:275380 8/22 (36%)
LRR_8 319..380 CDD:290566 22/61 (36%)
leucine-rich repeat 320..343 CDD:275380 8/22 (36%)
leucine-rich repeat 344..369 CDD:275380 10/25 (40%)
LRR_8 368..428 CDD:290566 12/59 (20%)
leucine-rich repeat 370..393 CDD:275380 5/22 (23%)
leucine-rich repeat 394..417 CDD:275380 6/22 (27%)
leucine-rich repeat 418..441 CDD:275380 2/22 (9%)
ConNP_001246635.1 LRR_RI <147..291 CDD:238064 45/163 (28%)
LRR_8 183..243 CDD:290566 21/83 (25%)
leucine-rich repeat 185..208 CDD:275380 3/22 (14%)
leucine-rich repeat 209..232 CDD:275380 10/46 (22%)
LRR_RI <225..416 CDD:238064 66/240 (28%)
LRR_8 232..291 CDD:290566 20/62 (32%)
leucine-rich repeat 233..256 CDD:275380 8/25 (32%)
leucine-rich repeat 257..280 CDD:275380 6/22 (27%)
leucine-rich repeat 281..304 CDD:275380 8/22 (36%)
LRR_8 304..363 CDD:290566 22/61 (36%)
leucine-rich repeat 305..328 CDD:275380 8/22 (36%)
leucine-rich repeat 329..352 CDD:275380 7/22 (32%)
LRR_8 352..416 CDD:290566 21/85 (25%)
leucine-rich repeat 353..376 CDD:275380 6/25 (24%)
LRRCT 414..>450 CDD:214507 11/54 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.