Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_611951.1 | Gene: | CG4781 / 37943 | FlyBaseID: | FBgn0035043 | Length: | 469 | Species: | Drosophila melanogaster |
Alignment Length: | 363 | Identity: | 94/363 - (25%) |
---|---|---|---|
Similarity: | 133/363 - (36%) | Gaps: | 116/363 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 227 GNRLSSI----------GLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNR 281
Fly 282 IRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDT 346
Fly 347 LDLSYNNLEFLEEQIFGGNTLP------RMRRLNLNGNRMKHLHPLAFSSLPF---LEYLKLGHN 402
Fly 403 ELKSLDVRMFAPMRRLQKLHLGHNLLEEI-------------------------------NLDVL 436
Fly 437 ESLSSVQEILVDNNR---------------------------------LTFLAKVNVSFPNLKRV 468
Fly 469 AIEGNPWQCPCFVKLQHWLATRDVVYLRDNTGYYKGER 506 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 13/38 (34%) |
LRR_8 | 104..164 | CDD:290566 | |||
leucine-rich repeat | 106..129 | CDD:275380 | |||
leucine-rich repeat | 130..153 | CDD:275380 | |||
leucine-rich repeat | 154..195 | CDD:275380 | |||
LRR_RI | 194..455 | CDD:238064 | 79/310 (25%) | ||
LRR_8 | 194..254 | CDD:290566 | 11/36 (31%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | |||
leucine-rich repeat | 220..243 | CDD:275380 | 7/25 (28%) | ||
leucine-rich repeat | 244..267 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 271..330 | CDD:290566 | 22/58 (38%) | ||
leucine-rich repeat | 272..295 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 296..319 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 319..380 | CDD:290566 | 20/66 (30%) | ||
leucine-rich repeat | 320..343 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 344..369 | CDD:275380 | 10/30 (33%) | ||
LRR_8 | 368..428 | CDD:290566 | 15/68 (22%) | ||
leucine-rich repeat | 370..393 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 394..417 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 418..441 | CDD:275380 | 12/53 (23%) | ||
CG4781 | NP_611951.1 | leucine-rich repeat | 90..108 | CDD:275380 | 8/19 (42%) |
LRR_8 | 108..167 | CDD:290566 | 22/63 (35%) | ||
leucine-rich repeat | 109..132 | CDD:275380 | 9/22 (41%) | ||
LRR_RI | <121..>261 | CDD:238064 | 45/152 (30%) | ||
leucine-rich repeat | 133..156 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 157..180 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 181..208 | CDD:275380 | 10/30 (33%) | ||
leucine-rich repeat | 230..253 | CDD:275380 | 7/25 (28%) | ||
leucine-rich repeat | 254..274 | CDD:275380 | 6/19 (32%) | ||
leucine-rich repeat | 275..299 | CDD:275380 | 0/23 (0%) | ||
leucine-rich repeat | 300..319 | CDD:275380 | 6/24 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR45617 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |