DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and CG5819

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001246458.1 Gene:CG5819 / 37547 FlyBaseID:FBgn0034717 Length:915 Species:Drosophila melanogaster


Alignment Length:347 Identity:100/347 - (28%)
Similarity:158/347 - (45%) Gaps:35/347 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GSGENADHL--ANLLDLDLTGAAPINVHTNGF-SILPNLRQLNLSGCGLVDIRGNHFAPESALQR 132
            |:||:.:.|  ::|.||.|:.....::..:.. :.||||.:|||:...|..|..   .|...|:.
  Fly   145 GNGESFELLTSSSLTDLGLSSCGISSIGGDQMVNQLPNLERLNLANNQLAQIAA---LPSRTLRV 206

  Fly   133 IDFSHNQMELLDRDFFGNLRKLIYANFSHNALKQCD-LPHMP----LLNRLELGHNRLVNATFGV 192
            :|.|:..::.|...|...::.|...|.|.|...|.| |...|    :|.:|::.:..|.:.....
  Fly   207 LDLSNCSIKNLSGFFLDAMQNLEALNLSRNTELQFDSLSEDPILTYMLRKLDVSYCNLDSIELSG 271

  Fly   193 CPQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDAL 257
            .|||.|:.|..|.|..:|||.|.....|..:.||.|.|..||.:.|..|.:|::|||:.|.:..|
  Fly   272 LPQLTEVRLQGNLLRVVDVNTFANNSMLEVVDLSQNVLRHIGQDAFAKLKRLKELNLAFNEIARL 336

  Fly   258 RPNVFGAVQNFVLH---LQQLDLSGN---RIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVG 316
            .       :||:.:   |.:|:||.|   ::..:..|..|.      :::|...|.|:.......
  Fly   337 D-------RNFIRNNDVLVELNLSRNVLQKLTKIVSNSVRT------INMSWCEITSIESTALSS 388

  Fly   317 LGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRM- 380
            |..::||.|..|.|.::  .||.....|..|:|:...|..:....|  ...|.:..|:|||||: 
  Fly   389 LSVIQKLDLSNNLITDM--PTFMRSETLQQLNLANCRLTTVRNNTF--REFPELADLHLNGNRLT 449

  Fly   381 KHLHPLAFSSLPFLEYLKLGHN 402
            ..:.|..|....||:.|.||.|
  Fly   450 SPIPPNYFDGNKFLDQLWLGDN 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 51/157 (32%)
LRR_8 104..164 CDD:290566 18/59 (31%)
leucine-rich repeat 106..129 CDD:275380 7/22 (32%)
leucine-rich repeat 130..153 CDD:275380 5/22 (23%)
leucine-rich repeat 154..195 CDD:275380 11/45 (24%)
LRR_RI 194..455 CDD:238064 66/216 (31%)
LRR_8 194..254 CDD:290566 25/59 (42%)
leucine-rich repeat 196..219 CDD:275380 9/22 (41%)
leucine-rich repeat 220..243 CDD:275380 9/22 (41%)
leucine-rich repeat 244..267 CDD:275380 6/22 (27%)
LRR_8 271..330 CDD:290566 15/64 (23%)
leucine-rich repeat 272..295 CDD:275380 7/25 (28%)
leucine-rich repeat 296..319 CDD:275380 4/22 (18%)
LRR_8 319..380 CDD:290566 18/60 (30%)
leucine-rich repeat 320..343 CDD:275380 7/22 (32%)
leucine-rich repeat 344..369 CDD:275380 5/24 (21%)
LRR_8 368..428 CDD:290566 15/36 (42%)
leucine-rich repeat 370..393 CDD:275380 8/23 (35%)
leucine-rich repeat 394..417 CDD:275380 5/9 (56%)
leucine-rich repeat 418..441 CDD:275380
CG5819NP_001246458.1 leucine-rich repeat 56..78 CDD:275380
LRR_RI <58..236 CDD:238064 26/93 (28%)
LRR_8 78..141 CDD:290566
leucine-rich repeat 79..102 CDD:275380
leucine-rich repeat 103..130 CDD:275380
leucine-rich repeat 131..155 CDD:275380 4/9 (44%)
LRR_8 156..214 CDD:290566 17/60 (28%)
leucine-rich repeat 158..182 CDD:275380 5/23 (22%)
LRR_8 202..285 CDD:290566 22/82 (27%)
leucine-rich repeat 204..227 CDD:275380 5/22 (23%)
leucine-rich repeat 254..274 CDD:275380 3/19 (16%)
LRR_8 273..333 CDD:290566 25/59 (42%)
leucine-rich repeat 275..298 CDD:275380 9/22 (41%)
LRR_RI 277..>471 CDD:238064 62/210 (30%)
leucine-rich repeat 299..322 CDD:275380 9/22 (41%)
LRR_8 321..402 CDD:290566 23/93 (25%)
leucine-rich repeat 323..346 CDD:275380 8/29 (28%)
leucine-rich repeat 347..391 CDD:275380 11/49 (22%)
leucine-rich repeat 392..413 CDD:275380 7/22 (32%)
LRR_8 393..448 CDD:290566 18/58 (31%)
leucine-rich repeat 414..437 CDD:275380 5/24 (21%)
LRRCT 471..517 CDD:214507 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.