DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and Lrt

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster


Alignment Length:421 Identity:115/421 - (27%)
Similarity:175/421 - (41%) Gaps:99/421 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 PNL---RQLNLS-GCGLVDIRGNHFAPESALQRIDFSHNQMELLDRDFFGNLRKLIYANFSHNAL 164
            ||:   |...|. ||.|         |.:....||. |..|.|.||     ||...|:    .:|
  Fly   133 PNITGTRNAELECGCDL---------PHTLRCNIDL-HGMMLLADR-----LRTSPYS----ISL 178

  Fly   165 KQCDLPHMPLLNRLELGHNRLVNATFGVCPQLQELILNDNQLIQLDVNAFRGLHGLLE-LQLSGN 228
            ..|.|.::..|:..::..|          ..|..|:::..::.::..:||.|:.|.|: |.|.||
  Fly   179 LDCSLRNVTFLSDAKIFDN----------VSLHGLVISSGEIKRVHKSAFLGIRGPLQALGLPGN 233

  Fly   229 RLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVL 293
            .|.|:                ..|||..|..            |::|||:.|:|:.|....|..|
  Fly   234 ALMSV----------------PWNALSTLSA------------LERLDLANNKIKALGTADFVGL 270

  Fly   294 ARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPA--TFAALLNLDTLDLSYNNLEF 356
            ..|..|::|.|.|:|:|...||.|..|..|.|..|.:.:...:  :.:..|:|..|||..|||..
  Fly   271 TSLVYLELSNNQISSISQRTFVNLRKLEVLKLGGNRLGDYAQSLRSLSQCLSLRQLDLQANNLNG 335

  Fly   357 -LEEQIFGGNTLPRMRR---LNLNGNRMKHLHPLAFSSLPFLEYLKLGHNE-------------- 403
             |.||     |||.||.   ||||.|.:|.:...|.::...|..|.|.||:              
  Fly   336 PLSEQ-----TLPGMRNLESLNLNRNLIKSIQNKALANFSRLVSLSLRHNQIDVLQDHAFFGLGA 395

  Fly   404 LKSLDV----------RMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKV 458
            |.|||:          .....:.||..|.|.||.|..:..|::..|.|::|:.:..|.::.:|:.
  Fly   396 LDSLDLSYNGIVAISSASLQHLSRLTVLDLTHNFLRALTSDLIAPLPSLRELRLAGNDISIVARN 460

  Fly   459 NV-SFPNLKRVAIEGNPWQCPCFVK-LQHWL 487
            .: ....|:.:.::.||..|.|.:: ...||
  Fly   461 AMDGARELESLQMQENPLSCDCSIRPFAEWL 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 39/156 (25%)
LRR_8 104..164 CDD:290566 18/63 (29%)
leucine-rich repeat 106..129 CDD:275380 6/26 (23%)
leucine-rich repeat 130..153 CDD:275380 8/22 (36%)
leucine-rich repeat 154..195 CDD:275380 6/40 (15%)
LRR_RI 194..455 CDD:238064 84/291 (29%)
LRR_8 194..254 CDD:290566 14/60 (23%)
leucine-rich repeat 196..219 CDD:275380 5/22 (23%)
leucine-rich repeat 220..243 CDD:275380 7/23 (30%)
leucine-rich repeat 244..267 CDD:275380 4/22 (18%)
LRR_8 271..330 CDD:290566 23/58 (40%)
leucine-rich repeat 272..295 CDD:275380 9/22 (41%)
leucine-rich repeat 296..319 CDD:275380 10/22 (45%)
LRR_8 319..380 CDD:290566 25/66 (38%)
leucine-rich repeat 320..343 CDD:275380 4/24 (17%)
leucine-rich repeat 344..369 CDD:275380 12/25 (48%)
LRR_8 368..428 CDD:290566 25/86 (29%)
leucine-rich repeat 370..393 CDD:275380 9/25 (36%)
leucine-rich repeat 394..417 CDD:275380 9/46 (20%)
leucine-rich repeat 418..441 CDD:275380 8/22 (36%)
LrtNP_001286640.1 LRR_RI <151..334 CDD:238064 62/230 (27%)
leucine-rich repeat 179..199 CDD:275378 4/29 (14%)
leucine-rich repeat 200..223 CDD:275380 5/22 (23%)
leucine-rich repeat 225..248 CDD:275380 11/38 (29%)
LRR_8 249..307 CDD:290566 23/57 (40%)
leucine-rich repeat 249..272 CDD:275380 9/22 (41%)
LRR_RI <270..479 CDD:238064 63/213 (30%)
leucine-rich repeat 273..296 CDD:275380 10/22 (45%)
leucine-rich repeat 297..322 CDD:275380 4/24 (17%)
LRR_8 322..382 CDD:290566 27/64 (42%)
leucine-rich repeat 323..347 CDD:275380 14/28 (50%)
leucine-rich repeat 348..371 CDD:275380 7/22 (32%)
LRR_8 370..428 CDD:290566 13/57 (23%)
leucine-rich repeat 372..395 CDD:275380 5/22 (23%)
leucine-rich repeat 396..419 CDD:275380 4/22 (18%)
LRR_8 418..478 CDD:290566 15/59 (25%)
leucine-rich repeat 420..443 CDD:275380 8/22 (36%)
leucine-rich repeat 444..467 CDD:275380 3/22 (14%)
LRRCT 476..526 CDD:214507 6/16 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.