DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and CG14762

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster


Alignment Length:425 Identity:104/425 - (24%)
Similarity:178/425 - (41%) Gaps:110/425 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 DLPHM-----------PLLNRLELGHNRLVNATFGVCPQLQ----------ELILNDNQLIQLDV 211
            ||.|:           |::..|:|.||.|        |:||          .|.::::.|..::.
  Fly    65 DLAHITKSMGTLKGKSPIIFYLKLRHNNL--------PKLQGFVFLALDIRHLTIHNSSLAAIEE 121

  Fly   212 NAFRGL-HGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVL----- 270
            ||...| .||.:|.:|.|::.::..:..|.|..|..|||:.|.:..:..|.|..::...:     
  Fly   122 NALSSLGAGLTQLDVSLNQMKTVPSQALQHLFHLLILNLNHNKITVIHNNAFEGLETLEILTLYE 186

  Fly   271 ----------------HLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGS 319
                            |:::|:|.||.:..:......:|:.|:.|::..|.|.::|...|.||.|
  Fly   187 NKITQIDPEAFRGLEDHIKRLNLGGNDLTNIPQKALSILSTLKKLEIQENKIRTISEGDFEGLQS 251

  Fly   320 LRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGG---------------NTLP- 368
            |..|.|.:|.|..:....|:.|..|::|:|..|.:..:::..|.|               :|:| 
  Fly   252 LDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAFKGLEENLQYLRLGDNQIHTIPS 316

  Fly   369 -------RMRRLNLNGNRMKHLHPLAFSSL-PFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGH 425
                   |:|.|:|..|.:..|...||:.. ..|.:|.|..|::|.|...:|..:..|:.|:|.:
  Fly   317 EALRPLHRLRHLDLRNNNINVLAEDAFTGFGDSLTFLNLQKNDIKVLPSLLFENLNSLETLNLQN 381

  Fly   426 NLLEEINLDVLESLSSVQEILVDNNRLTFLAKVNVSFPNLKRVAIEGNPWQCPC----FVKLQHW 486
            |.|:.|..|::|.       ::|..|:               :.|..||..|.|    |.||...
  Fly   382 NKLQRIPQDIMEP-------VIDTLRI---------------IDITDNPLNCSCELTWFPKLLED 424

  Fly   487 LATRDVVYLRDNTGYYKGERPLCIVT--NVDYCIQ 519
            |..:|     |.....|  :|||.::  |.:|.:|
  Fly   425 LKNKD-----DEMSQKK--KPLCHMSLDNREYFVQ 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 29/109 (27%)
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380 9/37 (24%)
LRR_RI 194..455 CDD:238064 77/316 (24%)
LRR_8 194..254 CDD:290566 20/70 (29%)
leucine-rich repeat 196..219 CDD:275380 7/33 (21%)
leucine-rich repeat 220..243 CDD:275380 6/22 (27%)
leucine-rich repeat 244..267 CDD:275380 7/22 (32%)
LRR_8 271..330 CDD:290566 19/58 (33%)
leucine-rich repeat 272..295 CDD:275380 5/22 (23%)
leucine-rich repeat 296..319 CDD:275380 8/22 (36%)
LRR_8 319..380 CDD:290566 21/83 (25%)
leucine-rich repeat 320..343 CDD:275380 7/22 (32%)
leucine-rich repeat 344..369 CDD:275380 8/47 (17%)
LRR_8 368..428 CDD:290566 20/68 (29%)
leucine-rich repeat 370..393 CDD:275380 7/23 (30%)
leucine-rich repeat 394..417 CDD:275380 7/22 (32%)
leucine-rich repeat 418..441 CDD:275380 8/22 (36%)
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380 8/27 (30%)
LRR_RI 93..384 CDD:238064 72/298 (24%)
leucine-rich repeat 107..129 CDD:275380 5/21 (24%)
leucine-rich repeat 131..154 CDD:275380 6/22 (27%)
LRR_8 154..214 CDD:290566 12/59 (20%)
leucine-rich repeat 155..178 CDD:275380 7/22 (32%)
leucine-rich repeat 179..203 CDD:275380 0/23 (0%)
leucine-rich repeat 204..227 CDD:275380 5/22 (23%)
LRR_8 226..286 CDD:290566 20/59 (34%)
leucine-rich repeat 228..251 CDD:275380 8/22 (36%)
leucine-rich repeat 252..275 CDD:275380 7/22 (32%)
LRR_8 276..335 CDD:290566 13/58 (22%)
leucine-rich repeat 276..300 CDD:275380 6/23 (26%)
leucine-rich repeat 301..324 CDD:275380 2/22 (9%)
leucine-rich repeat 325..349 CDD:275380 7/23 (30%)
LRR_8 349..409 CDD:290566 19/81 (23%)
leucine-rich repeat 350..373 CDD:275380 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.