Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001285960.1 | Gene: | CG18480 / 34920 | FlyBaseID: | FBgn0028518 | Length: | 550 | Species: | Drosophila melanogaster |
Alignment Length: | 231 | Identity: | 64/231 - (27%) |
---|---|---|---|
Similarity: | 99/231 - (42%) | Gaps: | 29/231 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 270 LHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIK 334
Fly 335 PATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKL 399
Fly 400 GHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKVNVSFP- 463
Fly 464 NLKRVAIEGNPWQCP-CFVKLQHWLATRDVVYLRDN 498 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | |
LRR_8 | 104..164 | CDD:290566 | |||
leucine-rich repeat | 106..129 | CDD:275380 | |||
leucine-rich repeat | 130..153 | CDD:275380 | |||
leucine-rich repeat | 154..195 | CDD:275380 | |||
LRR_RI | 194..455 | CDD:238064 | 51/184 (28%) | ||
LRR_8 | 194..254 | CDD:290566 | |||
leucine-rich repeat | 196..219 | CDD:275380 | |||
leucine-rich repeat | 220..243 | CDD:275380 | |||
leucine-rich repeat | 244..267 | CDD:275380 | |||
LRR_8 | 271..330 | CDD:290566 | 15/58 (26%) | ||
leucine-rich repeat | 272..295 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 296..319 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 319..380 | CDD:290566 | 25/60 (42%) | ||
leucine-rich repeat | 320..343 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 344..369 | CDD:275380 | 12/24 (50%) | ||
LRR_8 | 368..428 | CDD:290566 | 15/59 (25%) | ||
leucine-rich repeat | 370..393 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 394..417 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 418..441 | CDD:275380 | 6/22 (27%) | ||
CG18480 | NP_001285960.1 | LRR_8 | 74..134 | CDD:290566 | 21/59 (36%) |
LRR_RI | <76..230 | CDD:238064 | 51/179 (28%) | ||
leucine-rich repeat | 76..99 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 100..123 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 122..182 | CDD:290566 | 22/61 (36%) | ||
leucine-rich repeat | 124..147 | CDD:275380 | 12/24 (50%) | ||
leucine-rich repeat | 148..171 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 170..230 | CDD:290566 | 19/83 (23%) | ||
leucine-rich repeat | 172..195 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 10/46 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45453549 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |