DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and CG18480

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster


Alignment Length:231 Identity:64/231 - (27%)
Similarity:99/231 - (42%) Gaps:29/231 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 LHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIK 334
            ||.|:.....:..||:..| ..:...:::||:|.|.|.::....|.....|..|.|.:|||..:.
  Fly    51 LHAQRNRAVCSAKRLISAN-IEIPTTVELLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLY 114

  Fly   335 PATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKL 399
            ...|..|..|..||||||.||.::|.|...|.  ::..|||.||::..|........|.|..|.|
  Fly   115 GDAFVELTRLRYLDLSYNRLEQIDEHILESNN--QLIHLNLEGNKLSTLGKGPILRSPSLRSLNL 177

  Fly   400 GHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKVNVSFP- 463
            .::::..|..::.:.:.:|::|.|..|||                       || |:..:...| 
  Fly   178 RNSQVNQLGTQLLSALPQLRQLDLAQNLL-----------------------LT-LSPGDFHAPR 218

  Fly   464 NLKRVAIEGNPWQCP-CFVKLQHWLATRDVVYLRDN 498
            ||..:.:|.||:.|. ...|:...|..|.|.....|
  Fly   219 NLASLNVEENPFNCDRALAKVATGLRQRGVAIFMSN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380
LRR_RI 194..455 CDD:238064 51/184 (28%)
LRR_8 194..254 CDD:290566
leucine-rich repeat 196..219 CDD:275380
leucine-rich repeat 220..243 CDD:275380
leucine-rich repeat 244..267 CDD:275380
LRR_8 271..330 CDD:290566 15/58 (26%)
leucine-rich repeat 272..295 CDD:275380 4/22 (18%)
leucine-rich repeat 296..319 CDD:275380 6/22 (27%)
LRR_8 319..380 CDD:290566 25/60 (42%)
leucine-rich repeat 320..343 CDD:275380 8/22 (36%)
leucine-rich repeat 344..369 CDD:275380 12/24 (50%)
LRR_8 368..428 CDD:290566 15/59 (25%)
leucine-rich repeat 370..393 CDD:275380 6/22 (27%)
leucine-rich repeat 394..417 CDD:275380 4/22 (18%)
leucine-rich repeat 418..441 CDD:275380 6/22 (27%)
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566 21/59 (36%)
LRR_RI <76..230 CDD:238064 51/179 (28%)
leucine-rich repeat 76..99 CDD:275380 6/22 (27%)
leucine-rich repeat 100..123 CDD:275380 8/22 (36%)
LRR_8 122..182 CDD:290566 22/61 (36%)
leucine-rich repeat 124..147 CDD:275380 12/24 (50%)
leucine-rich repeat 148..171 CDD:275380 6/22 (27%)
LRR_8 170..230 CDD:290566 19/83 (23%)
leucine-rich repeat 172..195 CDD:275380 4/22 (18%)
leucine-rich repeat 196..219 CDD:275380 10/46 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453549
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.