Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_723576.1 | Gene: | CG5096 / 34410 | FlyBaseID: | FBgn0032235 | Length: | 491 | Species: | Drosophila melanogaster |
Alignment Length: | 337 | Identity: | 87/337 - (25%) |
---|---|---|---|
Similarity: | 145/337 - (43%) | Gaps: | 78/337 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 178 LELGHNRLVNATFGVCPQ--LQELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSS-------- 232
Fly 233 ---IGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRL---LFDNQFR 291
Fly 292 VLARLQMLDVSRNSIASLSPA--H-------FVGLGSLRKLYLQYNAILEIKPATFAALLNLDTL 347
Fly 348 DLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYL-KLGHNELKSLDVRM 411
Fly 412 FAPMRRLQKLHLGHN-LLEEINLDVLE---------SLSSVQEILVDNNRLTFLAK-VNVSFPNL 465
Fly 466 KRVAIEGNPWQC 477 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 29/90 (32%) |
LRR_8 | 104..164 | CDD:290566 | |||
leucine-rich repeat | 106..129 | CDD:275380 | |||
leucine-rich repeat | 130..153 | CDD:275380 | |||
leucine-rich repeat | 154..195 | CDD:275380 | 4/16 (25%) | ||
LRR_RI | 194..455 | CDD:238064 | 74/296 (25%) | ||
LRR_8 | 194..254 | CDD:290566 | 24/72 (33%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 220..243 | CDD:275380 | 10/33 (30%) | ||
leucine-rich repeat | 244..267 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 271..330 | CDD:290566 | 18/70 (26%) | ||
leucine-rich repeat | 272..295 | CDD:275380 | 5/25 (20%) | ||
leucine-rich repeat | 296..319 | CDD:275380 | 9/31 (29%) | ||
LRR_8 | 319..380 | CDD:290566 | 13/60 (22%) | ||
leucine-rich repeat | 320..343 | CDD:275380 | 3/22 (14%) | ||
leucine-rich repeat | 344..369 | CDD:275380 | 7/24 (29%) | ||
LRR_8 | 368..428 | CDD:290566 | 14/61 (23%) | ||
leucine-rich repeat | 370..393 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 394..417 | CDD:275380 | 4/23 (17%) | ||
leucine-rich repeat | 418..441 | CDD:275380 | 9/32 (28%) | ||
CG5096 | NP_723576.1 | LRR_RI | 69..378 | CDD:238064 | 83/331 (25%) |
leucine-rich repeat | 85..104 | CDD:275380 | 5/18 (28%) | ||
LRR_8 | 105..174 | CDD:290566 | 23/68 (34%) | ||
leucine-rich repeat | 105..128 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 129..163 | CDD:275380 | 10/33 (30%) | ||
LRR_8 | 163..222 | CDD:290566 | 18/62 (29%) | ||
leucine-rich repeat | 164..187 | CDD:275380 | 8/26 (31%) | ||
leucine-rich repeat | 188..214 | CDD:275380 | 5/25 (20%) | ||
leucine-rich repeat | 215..238 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 239..261 | CDD:275380 | 5/31 (16%) | ||
LRR_8 | 260..322 | CDD:290566 | 22/86 (26%) | ||
leucine-rich repeat | 262..286 | CDD:275380 | 8/27 (30%) | ||
leucine-rich repeat | 287..311 | CDD:275380 | 9/44 (20%) | ||
leucine-rich repeat | 346..369 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 370..388 | CDD:275380 | 6/13 (46%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR45617 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |