DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and CG5096

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster


Alignment Length:337 Identity:87/337 - (25%)
Similarity:145/337 - (43%) Gaps:78/337 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 LELGHNRLVNATFGVCPQ--LQELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSS-------- 232
            :.|.||.|.:..  :.|:  ::.|.|.:||:..:.|.||:.|..|:.|.||.|||:|        
  Fly    87 INLEHNNLTSVP--ILPKYDVENLYLANNQIDSISVGAFQNLTELVTLDLSHNRLTSKVLVPDVF 149

  Fly   233 ---IGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRL---LFDNQFR 291
               ..::.|:.|..|:.|||..|.|.:|..::|    ..:.|:::|.|..|...:   |.:....
  Fly   150 KGPFTVQDFESLENLKTLNLGYNDLHSLDADLF----EHIPHIEELVLCSNSFHVIDQLSETAIS 210

  Fly   292 VLARLQMLDVSRNSIASLSPA--H-------FVGLGSLRKLYLQYNAILEIKPATFAALLNLDTL 347
            .|..|::||||...|..|...  |       |:..|:|      :|.:    |.......||.:|
  Fly   211 GLQSLKILDVSYMEIDDLPDTILHGPRDLEIFIAAGNL------FNQL----PKALKYATNLTSL 265

  Fly   348 DLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYL-KLGHNELKSLDVRM 411
            .|:.|.:    |.:.|.|..|.:.:|.       ||      |:.|:..| |:|..        .
  Fly   266 VLNENPI----ENLIGDNVFPPLTKLT-------HL------SMTFMSKLYKIGPG--------A 305

  Fly   412 FAPMRRLQKLHLGHN-LLEEINLDVLE---------SLSSVQEILVDNNRLTFLAK-VNVSFPNL 465
            |:.::.|.:|.|..| ||.||:.:.|.         ....::::.::|..::.|.| :.|.:..|
  Fly   306 FSELQSLTELILSDNKLLNEIDEEALSKNVTGGQYLDYPPLEKVYLNNCNVSTLPKELLVRWDKL 370

  Fly   466 KRVAIEGNPWQC 477
            |.:.:..|||.|
  Fly   371 KALDLRFNPWNC 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 29/90 (32%)
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380 4/16 (25%)
LRR_RI 194..455 CDD:238064 74/296 (25%)
LRR_8 194..254 CDD:290566 24/72 (33%)
leucine-rich repeat 196..219 CDD:275380 8/22 (36%)
leucine-rich repeat 220..243 CDD:275380 10/33 (30%)
leucine-rich repeat 244..267 CDD:275380 8/22 (36%)
LRR_8 271..330 CDD:290566 18/70 (26%)
leucine-rich repeat 272..295 CDD:275380 5/25 (20%)
leucine-rich repeat 296..319 CDD:275380 9/31 (29%)
LRR_8 319..380 CDD:290566 13/60 (22%)
leucine-rich repeat 320..343 CDD:275380 3/22 (14%)
leucine-rich repeat 344..369 CDD:275380 7/24 (29%)
LRR_8 368..428 CDD:290566 14/61 (23%)
leucine-rich repeat 370..393 CDD:275380 4/22 (18%)
leucine-rich repeat 394..417 CDD:275380 4/23 (17%)
leucine-rich repeat 418..441 CDD:275380 9/32 (28%)
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 83/331 (25%)
leucine-rich repeat 85..104 CDD:275380 5/18 (28%)
LRR_8 105..174 CDD:290566 23/68 (34%)
leucine-rich repeat 105..128 CDD:275380 8/22 (36%)
leucine-rich repeat 129..163 CDD:275380 10/33 (30%)
LRR_8 163..222 CDD:290566 18/62 (29%)
leucine-rich repeat 164..187 CDD:275380 8/26 (31%)
leucine-rich repeat 188..214 CDD:275380 5/25 (20%)
leucine-rich repeat 215..238 CDD:275380 8/22 (36%)
leucine-rich repeat 239..261 CDD:275380 5/31 (16%)
LRR_8 260..322 CDD:290566 22/86 (26%)
leucine-rich repeat 262..286 CDD:275380 8/27 (30%)
leucine-rich repeat 287..311 CDD:275380 9/44 (20%)
leucine-rich repeat 346..369 CDD:275380 4/22 (18%)
leucine-rich repeat 370..388 CDD:275380 6/13 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.