DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and LRRC66

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001019782.1 Gene:LRRC66 / 339977 HGNCID:34299 Length:880 Species:Homo sapiens


Alignment Length:222 Identity:63/222 - (28%)
Similarity:103/222 - (46%) Gaps:33/222 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 LVNATF-GVCPQLQELILNDNQ---LIQLDVNAFRGL---HGLLE------LQLSGNRLSSIGLE 236
            |.|.:| |.|    ::.::.:|   .:.:..|.||.|   |...|      |.||.|.:|.|.|.
Human    43 LTNCSFTGKC----DIPVDISQTAATVDVSFNFFRVLLQSHTKKEEWKIKHLDLSNNLISKITLS 103

  Fly   237 TFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDV 301
            .|..|..|..||||.||:.:|..::.....::|          .|.|..|.|:|.:   |::|.:
Human   104 PFAYLHALEVLNLSNNAIHSLSLDLLSPKSSWV----------KRHRSSFRNRFPL---LKVLIL 155

  Fly   302 SRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNT 366
            .||.::. :|.....|.||:.|.|.:|.||:|..:.|...|.|:.|.|..|.:..:..|.|  ..
Human   156 QRNKLSD-TPKGLWKLKSLQSLDLSFNGILQIGWSDFHNCLQLENLCLKSNKIFKIPPQAF--KD 217

  Fly   367 LPRMRRLNLNGNRMKHLHPLAFSSLPF 393
            |.:::.::|:.|.:..:.|:...:|.|
Human   218 LKKLQVIDLSNNALITILPMMIIALEF 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 28/83 (34%)
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380 5/10 (50%)
LRR_RI 194..455 CDD:238064 58/212 (27%)
LRR_8 194..254 CDD:290566 22/71 (31%)
leucine-rich repeat 196..219 CDD:275380 5/28 (18%)
leucine-rich repeat 220..243 CDD:275380 10/28 (36%)
leucine-rich repeat 244..267 CDD:275380 8/22 (36%)
LRR_8 271..330 CDD:290566 16/58 (28%)
leucine-rich repeat 272..295 CDD:275380 5/22 (23%)
leucine-rich repeat 296..319 CDD:275380 6/22 (27%)
LRR_8 319..380 CDD:290566 19/60 (32%)
leucine-rich repeat 320..343 CDD:275380 8/22 (36%)
leucine-rich repeat 344..369 CDD:275380 7/24 (29%)
LRR_8 368..428 CDD:290566 5/26 (19%)
leucine-rich repeat 370..393 CDD:275380 4/22 (18%)
leucine-rich repeat 394..417 CDD:275380 63/222 (28%)
leucine-rich repeat 418..441 CDD:275380
LRRC66NP_001019782.1 LRR_RI 60..>255 CDD:238064 58/201 (29%)
leucine-rich repeat 64..86 CDD:275380 6/21 (29%)
LRR_8 86..160 CDD:290566 27/86 (31%)
LRR 1 86..107 8/20 (40%)
leucine-rich repeat 88..110 CDD:275380 9/21 (43%)
LRR 2 110..130 8/19 (42%)
leucine-rich repeat 111..149 CDD:275380 14/47 (30%)
LRR 3 149..171 5/25 (20%)
leucine-rich repeat 150..172 CDD:275380 6/22 (27%)
LRR_8 171..231 CDD:290566 19/61 (31%)
LRR 4 172..193 9/20 (45%)
leucine-rich repeat 173..196 CDD:275380 8/22 (36%)
LRR 5 196..217 6/22 (27%)
leucine-rich repeat 197..220 CDD:275380 7/24 (29%)
LRR 6 220..241 3/20 (15%)
leucine-rich repeat 221..242 CDD:275380 3/20 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 319..368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 463..504
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 679..746
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 764..816
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 855..880
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.