DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and CG42346

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001036303.2 Gene:CG42346 / 3355160 FlyBaseID:FBgn0259677 Length:1817 Species:Drosophila melanogaster


Alignment Length:614 Identity:159/614 - (25%)
Similarity:236/614 - (38%) Gaps:160/614 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLCMGFPILHGADLCQPIGWRNFQCSEVASLQDLVDLGAENWHTLAIRN---------------- 63
            ||.:.|..|.|..|      |..:....|.||||.:|.....|..||..                
  Fly   794 LLLLQFLDLSGNQL------RQLRRDYFAPLQDLEELSLARNHIEAIEGYAFAKLKNLKSLDLSH 852

  Fly    64 ---VQTELEVGSGE---NADHLANL------------------LDLDLTGAAPINVHT------- 97
               ||...::.|.|   |:.:|.|.                  |:|:.....|.::.|       
  Fly   853 NPLVQLTRDIFSNEFPLNSLNLGNCSLRKLEQHAFKSLTNLNELNLERNQLNPADIQTLDIPNLR 917

  Fly    98 ------NGFSI-------------LPNLRQLNLSGCGLVDIRGNHFAPESALQRIDFSHNQMELL 143
                  |.||.             |.:|:||::|.|.|..|....||..:.|.|:|...|::..:
  Fly   918 RLLLSHNNFSYAGSVGIMAGMLDRLRSLQQLSMSNCSLGQIPDLLFAKNTNLVRLDLCDNRLTQI 982

  Fly   144 DRDFFGNLRKLIYANFSHNALKQCDLPHMPLLN-----RLELGHNRLVNATF----GVCPQLQEL 199
            :|:.|..|..........|.|.  |.||:.|.|     .|:|..|:|.:..|    |.. .|::|
  Fly   983 NRNIFSGLNVFKELRLCRNELS--DFPHIALYNLSTLESLDLARNQLASIDFFKLSGTL-NLRQL 1044

  Fly   200 ILNDNQLIQLD-VNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFG 263
            ||.||::..|. .||. .|..|..:.||||.|.|:.....:....|:|::||.|....:..:...
  Fly  1045 ILRDNKITALSGFNAV-NLTQLDSVDLSGNLLLSLPANFLRHSINLQKVHLSNNRFLQIPSSALS 1108

  Fly   264 AVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYN 328
            .|.  :..|..|:|:||.|..::..:......|:.|.:.:.:::.|:...|....:|:.|:|..|
  Fly  1109 DVS--IPRLSWLNLTGNPINRIYTVKEERYPYLKELYICQTNLSILTSKDFEAFQALQHLHLVNN 1171

  Fly   329 AILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPF 393
            .|..|.|..|.:|.||.|||||.|.||.          ||:.|   |.|.|:             
  Fly  1172 RITRISPGAFKSLTNLLTLDLSVNELEM----------LPKER---LQGLRL------------- 1210

  Fly   394 LEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLT----- 453
            |.:|.:.||.||.|: .....:..:|.|.|..|.|:.|:.....:|..:.|:.:..||:|     
  Fly  1211 LRFLNISHNTLKDLE-EFSVDLLEMQTLDLSFNQLDRISKKTFRNLHGLLELFLMGNRMTVLSND 1274

  Fly   454 ---FLAKVNV---------SFP---------NLKRVAIEGNPWQCPCFV-KLQHWL--------- 487
               ||.|::|         ..|         ||:.:.:|.||..|.|.. ||..||         
  Fly  1275 AFRFLRKLHVLDLRKNYFELVPLEPLRPLETNLRTLRLEENPLHCSCDAQKLWEWLRDHRKWSLS 1339

  Fly   488 ----ATRDVVYLR-----DNTGYYKGERP 507
                |.|.:..|.     |:..|.:.|.|
  Fly  1340 MGSGAGRGIGGLTGGLGGDSINYLRCEHP 1368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 52/162 (32%)
LRR_8 104..164 CDD:290566 17/59 (29%)
leucine-rich repeat 106..129 CDD:275380 9/22 (41%)
leucine-rich repeat 130..153 CDD:275380 7/22 (32%)
leucine-rich repeat 154..195 CDD:275380 13/49 (27%)
LRR_RI 194..455 CDD:238064 76/269 (28%)
LRR_8 194..254 CDD:290566 22/60 (37%)
leucine-rich repeat 196..219 CDD:275380 10/23 (43%)
leucine-rich repeat 220..243 CDD:275380 7/22 (32%)
leucine-rich repeat 244..267 CDD:275380 6/22 (27%)
LRR_8 271..330 CDD:290566 14/58 (24%)
leucine-rich repeat 272..295 CDD:275380 6/22 (27%)
leucine-rich repeat 296..319 CDD:275380 4/22 (18%)
LRR_8 319..380 CDD:290566 24/60 (40%)
leucine-rich repeat 320..343 CDD:275380 9/22 (41%)
leucine-rich repeat 344..369 CDD:275380 10/24 (42%)
LRR_8 368..428 CDD:290566 16/59 (27%)
leucine-rich repeat 370..393 CDD:275380 4/22 (18%)
leucine-rich repeat 394..417 CDD:275380 7/22 (32%)
leucine-rich repeat 418..441 CDD:275380 7/22 (32%)
CG42346NP_001036303.2 leucine-rich repeat 303..325 CDD:275380
LRR_8 325..384 CDD:290566
leucine-rich repeat 327..350 CDD:275380
leucine-rich repeat 351..461 CDD:275380
LRR_8 373..433 CDD:290566
LRR_RI 397..648 CDD:238064
leucine-rich repeat 399..422 CDD:275380
leucine-rich repeat 462..485 CDD:275380
LRR_8 465..520 CDD:290566
leucine-rich repeat 486..509 CDD:275380
LRR_8 508..567 CDD:290566
leucine-rich repeat 510..533 CDD:275380
LRR_RI 527..785 CDD:238064
leucine-rich repeat 534..556 CDD:275380
LRR_8 555..613 CDD:290566
leucine-rich repeat 557..580 CDD:275380
leucine-rich repeat 581..604 CDD:275380
LRR_8 604..663 CDD:290566
leucine-rich repeat 605..628 CDD:275380
leucine-rich repeat 629..652 CDD:275380
LRR_8 652..711 CDD:290566
leucine-rich repeat 653..676 CDD:275380
leucine-rich repeat 677..700 CDD:275380
leucine-rich repeat 701..748 CDD:275380
leucine-rich repeat 725..736 CDD:275378
leucine-rich repeat 749..772 CDD:275380
LRR_8 771..831 CDD:290566 13/42 (31%)
leucine-rich repeat 773..793 CDD:275380
LRR_RI 804..1076 CDD:238064 71/281 (25%)
LRR_8 821..903 CDD:290566 14/81 (17%)
leucine-rich repeat 821..844 CDD:275380 5/22 (23%)
leucine-rich repeat 845..868 CDD:275380 4/22 (18%)
leucine-rich repeat 869..892 CDD:275380 3/22 (14%)
leucine-rich repeat 893..915 CDD:275380 4/21 (19%)
leucine-rich repeat 916..944 CDD:275380 4/27 (15%)
leucine-rich repeat 945..968 CDD:275380 9/22 (41%)
LRR_8 967..1027 CDD:290566 17/61 (28%)
leucine-rich repeat 969..992 CDD:275380 7/22 (32%)
leucine-rich repeat 993..1014 CDD:275380 6/22 (27%)
LRR_8 1015..1075 CDD:290566 21/61 (34%)
leucine-rich repeat 1017..1040 CDD:275380 6/23 (26%)
leucine-rich repeat 1041..1064 CDD:275380 10/23 (43%)
LRR_RI <1047..1244 CDD:238064 65/226 (29%)
LRR_8 1063..1125 CDD:290566 18/63 (29%)
leucine-rich repeat 1089..1114 CDD:275380 6/26 (23%)
leucine-rich repeat 1115..1162 CDD:275380 10/46 (22%)
LRR_8 1163..1219 CDD:290566 27/81 (33%)
leucine-rich repeat 1163..1186 CDD:275380 9/22 (41%)
leucine-rich repeat 1187..1210 CDD:275380 14/35 (40%)
leucine-rich repeat 1211..1233 CDD:275380 7/22 (32%)
leucine-rich repeat 1234..1257 CDD:275380 7/22 (32%)
LRR_8 1235..1292 CDD:290566 15/56 (27%)
leucine-rich repeat 1258..1279 CDD:275380 4/20 (20%)
leucine-rich repeat 1282..1306 CDD:275380 2/23 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453519
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.