DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and haf

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001356954.1 Gene:haf / 33339 FlyBaseID:FBgn0261509 Length:1347 Species:Drosophila melanogaster


Alignment Length:410 Identity:122/410 - (29%)
Similarity:168/410 - (40%) Gaps:86/410 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PLLLWL-LCMGFPILHGADLCQPIGWRNFQCSEVASLQD----LVDLGAENWHTLAIRNVQTELE 69
            ||||.| |.:|  .||.|....|  |:.    :|..||.    ..:||.|    |:::..|.:..
  Fly    16 PLLLLLPLILG--RLHVAHAQCP--WQR----DVPDLQTSCICAYNLGRE----LSVQCDQVDFS 68

  Fly    70 VGSGENADHLANLLDLDLTGAAPINVHTNGFSILP-------NLRQLNLSGCGLVDIRGNHF-AP 126
            ........| |.|..:||     :.|:.:..|.||       :|..|.||.||:..|....| ..
  Fly    69 QLLAAMNTH-ARLKPVDL-----LYVNNSTISELPDAVFSNLSLHNLQLSSCGIQRIATGAFKGQ 127

  Fly   127 ESALQRIDFSHNQMELLDRDFFGNLRKLIYANFSHNALKQCDLPHMPLLNRLELGHNRLVNA--- 188
            ||.|:.:                ||:..:.|:....|||.     :..||.|:|..|:|.:.   
  Fly   128 ESVLRNL----------------NLQDNLLADVPVEALKV-----LGKLNLLDLSKNQLSHIPDD 171

  Fly   189 TFGVCPQLQELILNDNQLIQLDVNAFRGL-HGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQN 252
            .|....:|..|.||||. :.|..|||||| ..|..|.|.|.:...:. |:.:.|..|..|:||||
  Fly   172 AFVGLTKLSTLKLNDNN-VTLASNAFRGLEQSLKNLNLKGTKQRKVP-ESIRGLKSLAFLDLSQN 234

  Fly   253 ALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGL 317
            .:..| |...|                  || :||.    |..|..|::.||.|.|:....|.|:
  Fly   235 GIKEL-PGAGG------------------IR-VFDG----LDALTALNLERNLIQSIGETAFAGV 275

  Fly   318 -GSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMK 381
             .:|..|.|..|.:.|.......:|..|..||:.:|.|..|.|..|.||  |.:..|.|:||.:.
  Fly   276 RKTLSSLSLLNNLLAEFPIGAVHSLKELRVLDIGFNLLTSLPEAAFRGN--PGITLLALDGNPLS 338

  Fly   382 HLHPLAFSSL-PFLEYLKLG 400
            .:...||:.| ..|..|.||
  Fly   339 SVPEGAFAHLNATLRGLSLG 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 51/164 (31%)
LRR_8 104..164 CDD:290566 15/67 (22%)
leucine-rich repeat 106..129 CDD:275380 9/23 (39%)
leucine-rich repeat 130..153 CDD:275380 3/22 (14%)
leucine-rich repeat 154..195 CDD:275380 11/43 (26%)
LRR_RI 194..455 CDD:238064 69/210 (33%)
LRR_8 194..254 CDD:290566 25/60 (42%)
leucine-rich repeat 196..219 CDD:275380 13/23 (57%)
leucine-rich repeat 220..243 CDD:275380 6/22 (27%)
leucine-rich repeat 244..267 CDD:275380 9/22 (41%)
LRR_8 271..330 CDD:290566 17/59 (29%)
leucine-rich repeat 272..295 CDD:275380 5/22 (23%)
leucine-rich repeat 296..319 CDD:275380 8/23 (35%)
LRR_8 319..380 CDD:290566 21/60 (35%)
leucine-rich repeat 320..343 CDD:275380 6/22 (27%)
leucine-rich repeat 344..369 CDD:275380 10/24 (42%)
LRR_8 368..428 CDD:290566 12/34 (35%)
leucine-rich repeat 370..393 CDD:275380 7/23 (30%)
leucine-rich repeat 394..417 CDD:275380 4/7 (57%)
leucine-rich repeat 418..441 CDD:275380
hafNP_001356954.1 LRR <52..>252 CDD:227223 70/256 (27%)
leucine-rich repeat 86..105 CDD:275380 4/18 (22%)
leucine-rich repeat 106..129 CDD:275380 8/22 (36%)
LRR_8 131..189 CDD:338972 20/79 (25%)
leucine-rich repeat 131..154 CDD:275380 7/43 (16%)
leucine-rich repeat 155..178 CDD:275380 7/22 (32%)
leucine-rich repeat 179..202 CDD:275380 13/23 (57%)
leucine-rich repeat 203..225 CDD:275380 6/22 (27%)
leucine-rich repeat 226..253 CDD:275380 14/50 (28%)
LRR_8 254..337 CDD:338972 29/84 (35%)
leucine-rich repeat 254..302 CDD:275380 14/47 (30%)
leucine-rich repeat 303..326 CDD:275380 10/24 (42%)
leucine-rich repeat 327..350 CDD:275380 7/22 (32%)
PCC 332..>413 CDD:188093 10/27 (37%)
PRK10927 <1061..>1097 CDD:236797
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.